- 2 ?9 ?9 u J P P A a??XvQQhh.JJDlRMYvvkQzWc8 R I L ; ; Farewell, $C. You'll be missed. farwaldipstikp5yulbemisd RA15,81,01,A15,81,01,A10,81,02, x E F G H l P P 34dP 34d We are gathered here to pay tribute to one of our own, $R $N. It is always sad to lose a pilot... atasalwasadtuluslusapilat RA45,81,01,A35,81,01,A50,81,02, ... but it is especially difficult when he is as young as $C. butatasaspasaledafacaltwanheasasyangasdipstik RA45,81,01,A35,81,01,A50,81,02, He died without even a chance to prove himself. hedidwatowtevenacanstupruvhamself RA45,81,01,A35,81,01,A50,81,02, x E F G H P 3 ST ST We are gathered here to pay tribute to one of our own, $R $N. In just a few missions, $C began what would surely have been a brilliant career. anjastafumisnsp3dipstikbeganwatwudsurlehavbanabralyantkarer RA45,81,01,A35,81,01,A50,81,02, Now that career has been cut short. nawtatcarerhasbancatsort RA45,81,01,A35,81,01,A50,81,02, Who can say what $C might have accomplished for the Confederation? hucansawatdipstikmithavakamplasdfortecanfadaratan RA45,81,01,A35,81,01,A50,81,02, x E F G H H hi hi We are gathered here to pay tribute to one of our own, $R $N. Without a doubt, $C was one of the Confederation's finest pilots. watowtadowtp3waswanaftecanfadaratonsfinestpilats RA45,81,01,A35,81,01,A50,81,02, Time after time, he led the Confederation forces to victory. timaftrtimp3heladtecanfadaratonforsastuvactore RA45,81,01,A35,81,01,A50,81,02, Now, as the Kilrathi enemy begins to flee the Vega Sector we bid farewell to a true hero. nawastekilratianamebeganstufletevagasactorwebadfarweltuatruhero RA45,81,01,A35,81,01,A50,81,02, x E F G H aP P We are gathered here to pay tribute to one of our own, $R $N. As we all know, the campaign for the Vega Sector has been long and hard. aswealnop3tecampanfortevagasectarhasbanloganhard RA45,81,01,A35,81,01,A50,81,02, No one fought harder to hold back the advancing Kilrathi horde than $C. nowanfathardrtuholdbakteadvansigkilratihordtandipstik RA45,81,01,A35,81,01,A50,81,02, Now he has made the ultimate sacrifice for the Confederation. nawhehasmadtealtamatsacrafisfortecanfadaraton RA45,81,01,A35,81,01,A50,81,02, d 3 l d d Dzd 9d Yad Jd jrd 9Xd 9X 01,01,02,02,03,03,04,04,05,05,06,06,07,07, Goodbye, Spirit ... I hope I can fill the gap you leave. gubai3spirat5aiopicanfiltegapulif RA45,81,01,A35,81,01,A50,81,02, 00,08, The Rec Room won't be the same without you, Hunter. Goodbye. terecrumwantbetesamwitawtu3hantir5gudbai RA45,81,01,A35,81,01,A50,81,02, 01,08, I hope someday I'll make you proud, Bossman. Goodbye. ihopsamdaialmaikuprawd3basman5gudbai RA45,81,01,A35,81,01,A50,81,02, 02,08, So long, Iceman. I'll see that the Kilrathi pay for what they've done. solan3asman5alsetatekilratipaiforwateyfdan RA45,81,01,A35,81,01,A50,81,02, 03,08, Au revoir, Angel. We will carry on the fight for you. awrefor3anjil5wiwilcariantefitforu RA45,81,01,A35,81,01,A50,81,02, 04,08, Goodbye, Paladin. I'll try to remember what you've taught me. gudbai3paladin5altraiturememarwatuftatmee RA45,81,01,A35,81,01,A50,81,02, 05,08, Goodbye, Maniac. I swear I'll get the furball that took you down. gudbai3maniac5iswaralgetefarbaltatukudawn RA45,81,01,A35,81,01,A50,81,02, 06,08, Don't worry, Knight. We'll finish the job for you. donwari3niit5wilfinistejabforu RA45,81,01,A35,81,01,A50,81,02, D E F G 9b d - P P Ab P P P P 9k P 4 P TUw P $ P DE P P CD P ; P P P 0g P P 67f P P 45q P 1 P QR P , P LM P N P no P L P lm P lm We are gathered here to pay our last respects to a good friend... ...and one of the Terran Confederation's boldest defenders. anwanafteterancanfederasansboldidefenars RA45,81,01,A35,81,01,A50,81,02, 01,05,02,09,03,13,04,17,05,21,06,25,07,29, Lieutenant Mariko Tanaka was one of our youngest pilots... lutenanmarikotanakawaswanafarungispilats RA45,81,01,A35,81,01,A50,81,02, ...but also one of our most promising. batalsowanafarmospramisin RA45,81,01,A35,81,01,A50,81,02, Her death robs both our own hearts and the future of the Confederation. herdetrabsbotarownartantefutaraftecanfedrasan RA45,81,01,A35,81,01,A50,81,02, 00,33, Captain Ian St. John was the maverick of the Tiger's Claw. capaniansainjanwastemafrikaftetigarclaw RA45,81,01,A35,81,01,A50,81,02, He pushed us to look at things in new and different ways. hepusustulukatinsinuandifranwais RA45,81,01,A35,81,01,A50,81,02, Now that we are without him, we must remember to keep an open mind... nawtatwiarwitawtim3wimasremambirtukipanopinmin RA45,81,01,A35,81,01,A50,81,02, ...and look for unconventional responses to the Kilrathi challenge. anlukfarancanfintanalrepansistutekilraticalanj RA45,81,01,A35,81,01,A50,81,02, 01,33, The Terran Confederation has lost one of its best leaders... teterancanfedrasanaslatwanafitbesledars RA45,81,01,A35,81,01,A50,81,02, ...Major Kien Chen, whom we all knew as Bossman. majorkienken3umwialnuasbasman RA45,81,01,A35,81,01,A50,81,02, Many of us, myself included, turned to Major Chen for advice from time to time. maniafas3maselfincudid3tarntumajorkenfaradfisframtimtutim RA45,81,01,A35,81,01,A50,81,02, Now we must find our own answers. nawimasfinarawnansirs RA45,81,01,A35,81,01,A50,81,02, 02,33, Major Michael Casey was easily one of our most brilliant pilots. majormikalcasiwasisaliwanafarmosbrilantpilats RA45,81,01,A35,81,01,A50,81,02, Though he rarely opened his heart to his fellow officers... tohirarliopintisartuisfelowafisars RA45,81,01,A35,81,01,A50,81,02, ...I feel sure that he would have wanted to die as he did... ifilsurtatiwudafwantitudaiasidid RA45,81,01,A35,81,01,A50,81,02, ...in combat with the Kilrathi, at the controls of a starfighter. incamatwitekilrati3atekantrolsafatarfitar RA45,81,01,A35,81,01,A50,81,02, 03,33, We are here to bid farewell to Captain Jeannette Devereaux... wearirtubidfarweltucaptinjenetdefaru RA45,81,01,A35,81,01,A50,81,02, ...our friend and comrade-at-arms. arfintancamradatarms RA45,81,01,A35,81,01,A50,81,02, The Tiger's Claw will miss both her piloting skills... tetigarsclawilmisboterpilatinskils RA45,81,01,A35,81,01,A50,81,02, ...and her fiery devotion to the Terran Confederation. andirfiridefotantuteterankanfedtrasan RA45,81,01,A35,81,01,A50,81,02, 04,33, Major James Taggart, one of our most seasoned veterans... majarjamstagart3wanafarmosesantfetrans RA45,81,01,A35,81,01,A50,81,02, ...has fallen in battle with the Kilrathi foe. hasfalininbatalwitekilratifow RA45,81,01,A35,81,01,A50,81,02, We will all miss Paladin's friendship, his wealth of experience... wewilalmispaladinfrinsip3hisweltafecspirans RA45,81,01,A35,81,01,A50,81,02, ...and his tales of the first battles against the Kilrathi. andistailsaftefirsbatalsagintekilrati RA45,81,01,A35,81,01,A50,81,02, 05,33, Now we say goodbye to one of the newest members of our Squadron... nawisaigudbaituwanaftenewesmembarsafarscwadran RA45,81,01,A35,81,01,A50,81,02, ...Lieutenant Todd Marshall, whom we all knew as Maniac. lutinantodmarsal3umwialnuasmanic RA45,81,01,A35,81,01,A50,81,02, His enthusiasm and confidence were models for us all... isentusasamancanfadinswirmadalsforasal RA45,81,01,A35,81,01,A50,81,02, ...it is a shame to see his career end so soon, and so unfortunately. itisasaimtuseiscarirensosun3ansoanfartunatli RA45,81,01,A35,81,01,A50,81,02, 06,33, Sadly, we must now say goodbye to Captain Joseph Khumalo. sadli3wimasnawsaigudbaitucaptinjosifkumalow RA45,81,01,A35,81,01,A50,81,02, Despite the pressures of the war we fight... depitepresarsuftewarwifit RA45,81,01,A35,81,01,A50,81,02, ...Captain Khumalo was always unaffected by the madness around him. captinkumalowasalwaisunafectidbaitemadnisarawnim RA45,81,01,A35,81,01,A50,81,02, He remained an island of stability for us, in a sea of insanity. heremantanalandaftabilitiforus3inaseeafinanity RA45,81,01,A35,81,01,A50,81,02, DUSRSQUADRONDA - . 2 0 1 2 3 4 y z , 8a ,bc ,R rs , ,?H ,8 XYfn , w N w ,Z ,Zw , ,Y , ,Oq , ,38 ,$Z z ,23q , ,? ,. ,a ,a Colonel Halcyon's office.1650 hours, $D. $N. Come in. I need to speak with you. dipstik3kaman3inedtuspekwatyu Yes, sir? yassar RA45,81,01,A35,81,01,A50,81,02, 10, I've been speaking with sector command. ivbanspekagwatsactrcamand The brass have been reviewing your record, and I have good news... tebrashavbanrevuagyorracord3adihavgudnus The order came in this morning ... I've been authorized to promote you. teordrcamantasmornag5ivbanawtorizdtupromotyu RA45,81,01,A35,81,01,A50,81,02, Congratulations, $R $N. Keep up the good work. cagrajulatans2captandipstik5kepaptegudwrk RA45,81,01,A35,81,01,A50,81,02, Thank you, sir. I'll do my best. tankyu2sir5ildumibast RA45,81,01,A35,81,01,A50,81,02, 21, Glad to hear it. Now, another thing I need to speak to you about... gladtuherat4nowanatrtaginedtuspektuyuabowt 21,15, That ship you just bailed out of cost over a hundred million credits. tatsapyujasbaldowtafcasovrahandrdmalyancradats It'll be weeks or months before the Tiger's Claw receives a replacement. atlbeweksarmantsbefortetigrsclaresevsareplasman RA45,81,01,A35,81,01,A50,81,02, I know, sir. ino3sar RA45,81,01,A35,81,01,A50,81,02, If you have no choice but to eject, then do it... afyuhavnojusbattuejekt4tenduat RA45,81,01,A35,81,01,A50,81,02, ...but don't let me catch you bailing out of a ship you could've flown home. batdontlatmecajyubalagowtafasapyucudavflownhom 18, You're about to receive a Golden Sun for ejecting and surviving... yurabowtturesevagoldnsanforejektagadsarvivag but you only get one of those per career. batyuonlygatwanaftosacarer RA45,81,01,A35,81,01,A50,81,02, After that, ejecting just wastes the Confederation's starfighters. aftrtat3ejektagjaswaststecanfadaratansstarfitrs RA45,81,01,A35,81,01,A50,81,02, I understand, colonel. I'll keep it in mind. iandrstad4karnal6ilkepatanmid RA45,81,01,A35,81,01,A50,81,02, 34, I'm counting on it, $R. imcowntaganat4kaptan RA45,81,01,A35,81,01,A50,81,02, 34, Just a moment, $C. I have one more thing to tell you. jasamoman3diptisk7ihavwanmortagtutalyu 33, We'll be leaving $S soon, and I need to make some personnel changes. welbelevagsastamsun3adinedtumaksamprsanalchajas RA45,81,01,A35,81,01,A50,81,02, Effective immediately following the jump, you'll be reassigned. efaktavamedeatlefaloagtejamp4yulbereasind 24, You'll be flying Hornets with the Killer Bees again. yulbefliaghornatswittekalrbesagan RA45,81,01,A35,81,01,A50,81,02, 25, I want you in a Scimitar-class medium fighter, with Blue Devil Squadron. iwanyuanasimitarclasmedeamfitr3wattebludavlskwadran RA45,81,01,A35,81,01,A50,81,02, 26, I need you in Star Slayer Squadron, flying a Raptor-class heavy fighter. inedyuinstarslaarskwadran5fliagaraptorclashavefitr RA45,81,01,A35,81,01,A50,81,02, 27, I want you in one of the new Rapier-class mediums, in Black Lion Squadron. iwanyuanwanaftenurapearclasmedeams4anblaklianskwadron RA45,81,01,A35,81,01,A50,81,02, 28, Yes, sir You won't be sorry yassar4yuwontbesarre$99 RA45,81,01,A35,81,01,A50,81,02, 33, Have I done something wrong, sir? havidansamtagwrag3sar RA45,81,01,A35,81,01,A50,81,02, It's nothing personal, $C. Just a simple matter of attrition. atsnatagprsanal3dipstik5jasasamplmatrafatratan RA45,81,01,A35,81,01,A50,81,02, As we lose ships and pilots from various squadrons... aswelussapsadpilatsframvareasskwadrans RA45,81,01,A35,81,01,A50,81,02, ...I have to shift personnel to keep the maximum number of fighters active. ihavtusafprsanaltukeptemaksamumnambraffitrsaktav RA45,81,01,A35,81,01,A50,81,02, I see, sir. isee3sar RA45,81,01,A35,81,01,A50,81,02, Good. I'm glad to hear it. gud5imgladtuherat RA45,81,01,A35,81,01,A50,81,02, That's all, then, $R. Dismissed. tatsalten2kaptan5dasmasd DUSRSQUADRONDA , h J N ,OT , K wLM bT 89st 89st Hangar deck.1700 hours, $D. 02,06, For meritorious conduct in confronting the Kilrathi enemy... formeritoreuskonductinkanfrontintekilratieneme 08, In consideration of his valorous service to humanity... incansadaratanafhasvalarasservastuhumanate leading the forces of the Confederation against the Empire of Kilrah... ledagteforsesaftecanfadaratanagansteampirafkalra taking a decisive role in the Vega Sector Campaign... takagadesisavrolantevagasactrcampan and commanding the squadron which accomplished the pivotal victory... adkamadagteskwadranwajakaplisdtepavatalviktore 08, For bravely sacrificing his vessel and endangering his life... forbravlesacraficaghassapadandajaraghaslif in combat with the Kilrathi enemy... incambatwattekalrateaname in the $S System, on or about $E, antehuhasastam4anarabowtarglbarglbazfaz the Terran Confederation is proud to present the $A to $R $N. tetarancanfadaratanasprowdtupresnttewetnudletukaptandipstik 11,12, Your courage is exemplary of the Confederation's finest defenders. 13, History shall number you among the greatest heroes of humanity. 13, Your devotion to the Confederation honors all humanity. Good job, $C.Congratulations. gudjabdipstikcangratulatons$20 RA45,81,01,A35,81,01,A50,81,02, Thank you, sir. Tankyusr$30 RA45,81,01,A35,81,01,A50,81,02, Filled with pride, you meet the applause of your fellows. m a 0 F 1 2 m 2 .z Z z 2 DU 2 uv 7 ; .H d w , , ,' f F ;J K A 3p P d d Mission Briefing,Enyo System, $T hours, $D. We've got a lot of work to do, people, so let's get to it. wevgotalotofwerktodopepulsolesgettoit The Tiger's Claw dropped from jumpspace seven hours ago, at 0800. tetigrscladrapdframjampspassavnowrsagop4ato2athandred RA45,81,01,A35,81,01,A50,81,02, Blue Devil squadron had first patrol. You Killer Bees have the next shift. bludevlsqwadrantuktefrstpatrolsiftyukillrbeestakovratsikstenhandred RA45,81,01,A35,81,01,A50,81,02, You rookies'll be flying with experienced pilots on your first missions. yurukeslbefliangwitakspereansdpilatsanyorfrstmsns RA45,81,01,A35,81,01,A50,81,02, I want the rookies to fly as wingleaders.You vets keep an eye on the kids out there. iwantterukestufliaswigledrsp4yuvatskepaniontekidsowttar RA45,81,01,A35,81,01,A50,81,02, Here are the assignments. herarteasinmants RA45,81,01,A35,81,01,A50,81,02, $C, you're leading Alpha wing. dipstikp3yurledigalfawig RA45,81,01,A35,81,01,A50,81,02, Spirit will fly on your wing. She's quiet, but she knows the ropes. p10$100 RA5,81,01,A35,81,01,A30,81,02, You're the wingleader, but if Spirit talks, you be sure and listen. Got it? yurtewigledrp3batafsparatsassamthigyubesurandlistnp3gotit RA45,81,01,A35,81,01,A50,81,02, Yes, sir. yassar RA5,81,01,A10,81,01, Good. Here's your patrol plan, then. gud3hirsyurpatrlplan2then RA5,81,01,A10,81,01, Computer, display Alpha. camputr3dasplaalfa You'll check three possible jump points, at about 20,000 klicks out. There are asteroids near Nav Points 2 and 3, so stay on course. Any questions? Yes, commander. What are we to do if we encounter the enemy? yas2comndurp4watrwetuduafweancowntrthanami RA35,81,01,A35,81,01,A50,81,02, Engage, if the odds look good. Let $C make the call. angajp4ifteadslukgudp4latdipstikmaktecal RA5,81,01,A10,81,01, Next is Beta wing... nakstazbatawag RA5,81,01,A10,81,01, Your thoughts wander as the commander makes the rest of the assignments. ...and back to the Tiger's Claw. adbaktutatigrzcla Remember ... this is no trainsim. If you see the enemy, he'll be out to kill you. ramambrp7tasasnotransamp4afyuencuntrteanamep4helbeowttukilyu RA45,81,01,A35,81,01,A50,81,02, Be sure you do it to him before he does it to you. besuruduittutembeforthedasituyu RA20,81,01,A35,81,01,A30,81,02, Squadron dismissed. $ F i F OP U 4 K NO P . F NO N P F T F I F ijU P NOo K P 3uF U a P ;Q F qv P F $; F Am K nu K T P tu P tu Mission debriefing. $T hours, $D $10, Welcome back, $C. Looks like you survived your first trip out. walcambakdipstikp5itlukslikyusarripowt RA45,81,01,A35,81,01,A50,81,02, 0,5, He is a very able pilot, commander. It is an honor to fly on his wing. heasavaryablpilatcamandrp8atasananartuflianhiswig RA45,81,01,A35,81,01,A50,81,02, That's high praise coming from Spirit. You should be proud, $C. tatshiprascamigframsparatp5yusudbeprowddipstik 120,RA35,81,01,A40,81,01,A50,81,02, 9, But Spirit, sir. She didn't make it back... batsparatsrp3sedadntmakitbak 525,81,03,515,RA45,81,01, This is a war, son, not some flight simulator. tasasawarsan3natsamflitsamulator RA45,81,01,A35,81,01,A50,81,02, Young men and women die in wars. She knew that when she signed up. yungmenanwamandianwarsp5senutatwansesindap RA45,81,01,A35,81,01,A50,81,02, You didn't do anything wrong $C, so don't hold yourself responsible. yudidntduanethigrogowttarp3sodantholdyorsalfrespansabl RA45,81,01,A35,81,01,A50,81,02, In any case, you flew well out there. I've reviewed the mission report from your flight recorder. inanecasp3yubotfluwalowttarp5ivrevudtemisnreportframyorflitcamputr RA45,81,01,A35,81,01,A50,81,02, 23, I see you made it back. . . barely. iseyumadatbakp8barle R645,81,01,650,81,01,635,81,02, 0,18, After a performance like that, you're both lucky to be alive. aftraparformansliktat2yorbotlaketubealiv R645,81,01,635,81,01,650,81,02, Spirit, I know you can do better than that. A25,81,010,R435,81,03,430,81,04, I'm sorry, sir. I shall try to do better in the future. imsaresr2p3isaltritudubatrintefutur 425,81,04,RA35,81,03,A30,81,04, And you, $C. What have you got to say for yourself? anyudipstikp5wathavyugattusaforyorsef R645,81,01,635,81,01,650,81,02, Nothing, sir. I won't make any excuses. natagsrp9iwontmakaneakskusas 415,81,02,RA45,81,01,A35,81,01,A50, Good, because there aren't any. gudp5becastararntane R645,81,01,635,81,01,650,81,02, If you two don't shape up, you'll both be flying garbage scows. afyutudontsapapp3yulbotbefliaggarbajscows 625,R81,01,A45,81,01,A35,81,01,A50, 0,23, I hear it got pretty rough out there.How are you feeling? iheratgatpraterafowttarp8howaryrfelig RA45,81,01,A35,81,01,A50,81,02, I'll be alright, sir. ilbealritp2sr2 420,R81,02,A45,81,01,A35,81,01,A50, It's not going to get any easier. atsnatgoigtugetaneesear RA45,81,01,A35,81,01,A50,81,02, Today it was Spirit that didn't come home... tudaatwasspirittatdadntcamhom RA45,81,01,A35,81,01,A50,81,02, ...tomorrow it may be you. tumaroatmitbeyu RA45,81,01,A35,81,01,A50,81,02, Let's go over the mission report. latsgoovrtemasnreport RA45,81,01,A35,81,01,425,81,02, 25, You got $K of the hairballs, $C... ugotsumaftheharbahls3dipstik 26, Recorder shows no kills for you, $C... camputershosnokilsfaru3dipstik 27, and $L Kilrathi for Spirit. adfivkilratheforspirit 28, and Spirit came up empty. adsparatcamupemte 0,29, And of course, Spirit didn't make it back. adafcors4sparatdadntmakatbak RA45,81,01,A35,81,01,A50,81,02, 30, Drop by my office in a couple of hours, $C ... I need to speak to you. addipstik4iwanttuseyuanmiafisanacaplafowrs RA45,81,01,A35,81,01,A50,81,02, That's all, then. Dismissed. tatsalten4dasmasd RA45,81,01,A35,81,01,A50,81,02, A , F f g 9q Ty G G Belly on up, friend, and take a load off. baleapfradadtakalodaf2$99 RA45,81,01,A35,81,01,A50,81,02, You must be $C. I'm Shotglass. Welcome aboard the Claw. yumasbedipstik4imsatglas5walcamabordtecla RA45,81,01,A35,81,01,A50,81,02, Used to be a pilot myself... ustabeapilatmisaf RA45,81,01,A35,81,01,A50,81,02, ...till the fleabags shot me up so bad I couldn't fly. talteflebagssatmeapsobadicadnfli R81,01,A35,81,01,A50, I guess I flew with most every pilot on the Claw. igasifluwatmosavrepilatantecla RA45,81,01,A35,81,01,A50,81,02, So if you want to know how one pilot or another flies... soafyuwantunohowwanpilatoranathrflis RA45,81,01,235,81,01,A25,81,02,130,81,01, ...old Shotglass is the guy to ask olsatglasastegituask$99 R81,01,A35,81,01,A40, Stop by when you're off duty and we'll talk more. stopbywhenurafduteanweltakmor RA30,81,01, A q A F 56kF A 45A VF vwF vw Bonjour, Lieutenant. You are called $C, no? I am called Angel. banzurlutanant3yuarcalddipstik2no2p8iamcaldanjl RA45,81,01,A35,81,01,A50,81,02, I am just reviewing some figures on our recent encounters with the Kilrathi. iamjasrevuagsamfagursanowrresantankowntrswatzekalrate RA45,81,01,A35,81,01,A50,81,02, You would like to know what I have learned, perhaps? yuwadliktunowatihavlrndprhaps RA45,81,01,A35,81,01,A50,81,02, The Dralthi is the Kilrathi fighter seen most in this sector. tedralteastekalratefitrsenmosantassaktr 425,R81,02,A45,81,01,A35,81,01,A50, These figures show that 1.4 missiles are required to destroy the Dralthi, tesfagurssotatwanpuntformaslsarrekwirdtudestroetedralte R445,81,01,435,81,01,A50,81,02, while over seven direct laser hits are necessary to destroy the same vessel. wilovrsavndiraklasrhatsarnasasaretudestrosamvasl R445,81,01,435,81,01,A50,81,02, I hope this information is useful to you, Lieutenant. ihoptisanformasanasusfltuyu3lutanant RA45,81,01,A35,81,01,A50,81,02, F e U aK P 6l2 F Ai F $TqF F Och, laddy, take a seat an' tilt a glass with ol' Paladin. okladetakasetanteltaglaswatolpaladan$99 RA45,81,01,A35,81,01,A50,81,02, I recall once when I was just a lieutenant like yourself there... irecalwanswaniwasjasalutanant3likyurseftar RA45,81,01,A35,81,01,A50,81,02, We were flyin' patrol o'er Accord, the fourth planet in the Alliance System. wewarflianpatroloraliansfor RA45,81,01,A35,81,01,A50,81,02, These four Kilrathi Salthi came zoomin' in with the sun at their backs... tesforkalratesaltecamzumananwattesanattarbaks RA45,81,01,A35,81,01,A50,81,02, 4,6, What is the point, monsieur? There is one, oui? watestepuntmasur2p5thiriswon3we R145,81,01,135,81,01,150,81,02, I was leadin' up ta it, lass. iwaslednaptuatlas R245,81,01,235,81,01,250,81,02, That day, we learned that a Salthi will always turn ta the left... tada3welrndtatasaltewalalwastrntuatslef RA45,81,01,A35,81,01,A50,81,02, It's got somethin' ta do with the way 'er engines an' ducts are arranged. itsgatsamthantadowattewataranjnsanduksararanjd RA45,81,01,A35,81,01,A50,81,02, So when you tail a Salthi, watch ta the left... sowanyutalasaltep3wajtatelaf RA45,81,01,A35,81,01,A50,81,02, That's where 'e'll go when 'e makes 'is break tatswarhelgowanhemaksasbrak RA45,81,01,A35,81,01,A50,81,02, F z R S 2 T Z y $e , ? , , G gh abmvA ? 2 FG FG Mission Briefing,Enyo System, $T hours, $D.Forty minutes into the briefing... 0,2, Epsilon Wing is $C and Spirit. apsalanwigasdipstikadsparat 0,3, Epsilon Wing is you, $C. We're short on manpower, so you'll be flying solo. apsalanwigasyu3dipstikp5wershortanmanpowr3soyulbefliagsolo You'll be escorting a Drayman-class transport to its jumppoint. yulbeascortigadramanclastransporttuatsjumppunt Computer, display Epsilon. camputr3dasplaapsalan Let's take a look at your flight plan. latstakalukatyurflitplan You'll rendezvous with the transport upon launch. Escort it to Nav Point 1... ...and on to Nav 2, where it will initiate jump sequence. Once its jumped out, you'll return by the most direct route. Remember...your job is to make sure that transport jumps out. remambr4yurjabastumaksurtattranpsortjampsowt RA45,81,01,A35,81,01,A50,81,02, I don't want you leaving her to chase down bogies. idontwantyulevighartujasdownboges A45,81,01,A35,R81,01,R650,81,02,640, If the enemy retreats, you stay with the transport. afteanameretretsp4yustawittetransport 645,RA45,81,01,A35,81,01,A50,81,02, Questions? kwastans RA5,81,01,135,81,01,A30,81,02, 0,15, Yes, sir. Why is Nav 1 so far out of the way? i2sarp8wiasnavwansofarowtaftewa RA45,81,01,A35,81,01,A50,81,02, 0,16, Yes, sir. Why is Nav 1 so far out of the way? i2sarp8wiasnavwansofarowtaftewa RA45,81,01,A35,81,01,A50,81,02, There's an asteroid field between the Tiger's Claw and the jumppoint. tarsanastarodfeldbetwentetigrsclaadtejumppont 115,RA45,81,01,A50,81,01, A fighter might navigate it, but a Drayman 'sport would never make it through. afitrmitnavagatatp4batadramansportwudnavrmakattru RA45,81,01,A50,81,01, Anything else? anetigals RA45,81,01,135,81,01,A50,81,02, All right, then. Let's get to work. alrit2tan5latsgattuwrk R245,81,01,A35,81,01,150,81,02,A35,81,02, Squadron dismissed. $ B V W 7 S7 wx F fg 2 u 2 02 PQo c LM 2 Je 2 2 38O 2 2 Mx F 2 EFcu 2 EFcu Mission debriefing. $T hours, $D. $9, Good job out there, $C. gudjabowttardipstik 2,3, The 'sport jumped right on schedule. You covered her well. tesportjampdritanskadul3p2yucavrdharwall RA45,81,01,A35,81,01,A50,81,02, 0,8,0,5, Thank you, sir, but Spirit deserves as much credit as I do. tankyusarp3batsparatdesrvsasmajkradatasidu A45,81,01,A35,R81,02,250,81,01,235, $C-san is too kind, sir. I only flew on his wing. walcambakdipstikp5yudadwallforyorfrstpatrol 125,81,02,130,R81,02,A45,81,01,A35, 0,8, Thank you, sir. I'm sorry about Spirit. tankyusar2p5imsareabowtsparat A45,81,05,R435,81,03,450,81,02, I know, son. Spirit was a good pilot, and a loyal friend. ino2san8sparatwasagudpilat3adaloalfred A45,81,03,A35,R81,05,435,81,04,440, 2,8, But the transport jumped out on schedule, so her death was not for nothing. battetranpsortjampdowtanskedul3p6sohrdatwasnatfornatig 425,81,03,RA45,81,01,A35,81,01, At any rate, that was some nice flying. atanerat3tatwassamnisfliag RA45,81,01,A35,81,01,A50,81,02, 15, Pretty hectic out there, eh? pratehaktikowttar3a2 RA45,81,01,A35,81,01,A50,81,02, Yes, sir. It got pretty busy. yassar2p4itgatpratebaze 415,81,04,415,81,02,RA45,81,01,A35, 2,13, At least the 'sport jumped out intact. atlestesportjampdowtantakt RA45,81,01,A35,81,01,A50,81,02, If it hadn't, you'd have been headed for the infantry on the next 'sport out. afathadntyudhavbanhadadforteanfantreantenekstsportowt RA15,81,01,A15,81,01,A10,81,02, 0,15, I don't know if you were hot-dogging or asleep at the stick... aftraparformansliktat2yorbotlaketubealiv A15,R645,81,01,655,81,01,650,81,01, ...but you better make sure it never happens again butyubatrmaksuratnavrhapnsagan R645,81,01,655,81,01,650,81,01, Well, let's review the mission report. wellestakalookattemissnreprt RA45,81,01,A35,81,01,450,81,02, 17, $C, you took out $K Kilrathi... dipstik3utokowtsumkilrathe R445,81,01,A35,81,01,A50,81,02, 18, $C, you came up empty... dipstik3ucamupemte R445,81,01,A35,81,01,A50,81,02, 0,20,19, and Spirit got $L of them. adsparatgatfaftenaftem R445,81,01,A35,81,01,A50,81,02, 20, and Spirit struck out. adsparatstrakowt R445,81,01,A35,81,01,A50,81,02, 2,21, The Drayman 'sport made its jump on schedule. tedramansportmadatsjampanskadul RA45,81,01,A35,81,01,A50,81,02, 2,22, We lost the Drayman. welasttedraman R445,81,01,A35,81,01,A50,81,02, 0,23,0,23, And of course, Spirit didn't make it back. adafcors4sparatdadntmakatbak RA45,81,01,A35,81,01,A50,81,02, 24, And $C ... I want to see you in my office in a couple of hours. addipstik4iwanttuseyuanmiafisanacaplafowrs RA45,81,01,A35,81,01,A50,81,02, That's all, then. Dismissed. tatsalten4dasmasd RA45,81,01,A35,81,01,A50,81,02, A L l r 9h F Lc2 F 'bF 'b Hear you flew with Spirit yesterday, $C. heryufluwatsparatyestrda2dipstik RA45,81,01,A35,81,01,A50,81,02, 0,4, She's a quiet little thing, but she's a heckuva flier. sesakwiatlatlteg3batsesahakavafliar RA45,81,01,A35,81,01,A50,81,02, She's rock-steady, follows orders, don't fire till she's sure of her shot. sesrakstade2falosordrs3dontfirtalsessurafhrsat RA45,81,01,A35,81,01,A50,81,02, I was always glad to have Spirit on my wing when I was still flying. $5iwasalwasgladtuhavsparatanmiwagwaniwastalfliag$10 RA45,81,01,A35,81,01,A50,81,02, 0,7, Damn shame she didn't make it back. damshamshedidnmakitbak RA45,81,01,A35,81,01,A50,81,02, Don't take it personal, kid. Spirit was a good flier, and she knew the risks. dontakatprsanl2kadp5sparatwasagudfliar3adsenuterisks RA45,81,01,A35,81,01,A50,81,02, Still, I wish I had my hands on the fleabag that got her still5iwasihadmihansanteflebagtatgathr RA45,81,01,A35,81,01,A50,81,02, 6 X x F XF xy2 D de 0W 0W You're $C, right? They call me Hunter, mate. G'day. yurdipstik2rit4tacalmedartmat3gda RA45,81,01,A35,81,01,A50,81,02, 0,2, Spirit 'ere was tellin' me about your tumble with the hairballs. sparatherwastalanmebowtyurtamblwatteharbals RA45,81,01,A35,81,01,A50,81,02, Sounds like you really mixed it up out there. sownslikyurelemaksdatapowttar RA45,81,01,A35,81,01,A50,81,02, 'At's the way, isn't it, mate? atstewa3adnatmat RA45,81,01,A35,81,01,A50,81,02, Just you and some hairball, twistin' about, tryin' t'get a missile lock... jasyuadsamharbal3twastnabowt2triantgatamasllak RA45,81,01,A35,81,01,A50,81,02, Formations, uniforms, medals, wingmen ... that's all sheepdip. formatansunaformsmadalswagmanp5alatssepdap RA45,81,01,A35,81,01,A50,81,02, All a bruce can count on out there is 'imself and 'is missiles. alabruscancownanowttarasamsefadasmasls RA45,81,01,A35,81,01,A50,81,02, L F l m ? F 9n2 5O2 ot2 5d Konichi-wa, $N-san. Please take a seat. konejewadipstiksan4plestakaset$25 RA45,81,01,A35,81,01,A50,81,02, If I may say so, you are doing quite well. afimitsaso3yuarduagkwitwal RA45,81,01,A35,81,01,A50,81,02, $5, Colonel-sama is most pleased with your performance thus far. kr2nlsamaasmostplesdwatyurpr2formanstasfar RA45,81,01,A35,81,01,A50,81,02, There was no need to praise me before him, though, honorable $R. tarwasnonedtuprasmebeforhamtoanarabllutanant RA45,81,01,A35,81,01,A50,81,02, The credit for a mission's success is due its leader, not his assistants. tecradatforamassansaksasasduitsledrp3nathasasastants RA45,81,01,A35,81,01,A50,81,02, I see by your expression that you do not believe me. isebiyuraksprasantatyudunatbelevme$33 RA45,81,01,A35,81,01,A50,81,02, I assure you I speak what is in my heart. iasuryuispekwatasanmihart RA45,81,01,A35,81,01,A50,81,02, 10, We both survived to challenge our enemies another day. webotsarvavdtuchalanjaranamesanatrda RA45,81,01,A35,81,01,A50,81,02, No mission from which you return is a total failure. Remember that. nomasnframwijyuretarnasatotlfalur2p5remambrtat RA45,81,01,A35,81,01,A50,81,02, Our race needs live pilots far more than it needs dead heroes. arrasnedslivpilatsfarmortanatnedsdadheros RA45,81,01,A35,81,01,A50,81,02, 9 t w Y Z A K A 2 F 78d F 7 WXs,,Y,Z F 6? F d 4 2 56Wod pq d Mission Briefing.McAuliffe System, $T hours, $D.Fifteen minutes into the briefing... Alright, then. Beta wing will be led by $C. alrittan4batawagwalbeladbidipstik Paladin, you'll be flying on his wing. RA45,81,01,A35,81,01,A50,81,02, An' I canna tell you 'ow I'm lookin' forward to it, Colonel. anicanatalyuomlookinforwirdtoitkernal$30 RA45,81,01,A35,81,01,A50,81,02, Right. rit 135,81,01,140,R81,01,A45, Since we jumped into the McAuliffe system just a few hours ago... sanswejampdantutegatwasastmjasafuowrsago RA45,81,01,135,81,01,A50,81,02,240,81,01, ...we're still running preliminary patrols. werstalranagprelamnarepatrols RA45,81,01,135,81,01,A50,81,02,240,81,01, $C, you'll be flying a four-point route, checking several potential jump points. dipstik3yulbefliagaforpuntrut2jakagsavralpotnjaljampunts RA45,81,01,A35,81,01,A50,81,02, Here's your flight plan... hersyorflitplan RA30,81,01, Just fly to the Nav Points, and make sure they're clear. jasflitutenavpunts3admaksurthardcler Long-range scanners indicate some sort of debris near Nav 3... lagrajscanrsandacatsamsortadabrenernavtre We have reason to believe this might be a Kilrathi mine field... wehavresntubelevtasmitbeakalrateminfeld ...so be especially careful in that area. sobeaspaslecarfalantatarea RA5,81,01,135,81,01,A30,81,02, Questions? kwastans RA45,81,01,135,81,01,A50,81,02, Alright, then. Delta wing is Iceman and Angel... alritten3deltawagasismanadangl A45,81,01,A35,81,01,R250,81,02, You listen as the colonel completes the mission assignments. yulisnastekarnalcmpletstemasnasinmats That's everyone. Last questions? tatsavrewan4laskwastans No hands are raised. Good. Let's get to work. Squadron dismissed. $ 2 K L M y F 7g F K F JK P ;s 2 56s 4M NSnF 2 z2 z Mission debriefing. $T hours, $D. $7, Well flown, $C. walflown3dipstik You handled those fleabags like an old pro. yuhandldtosflebagslikanoldpro RA45,81,01,A35,81,01,A50,81,02, 5,5, Thanks, sir. Having Paladin on my wing made it easy. tankssarp3havagpaladananmiwagmadatese A45,81,01,A35,R81,02,250,81,01,235, Now laddy, don't brag on me, or the colonel'll start expectin' more from me nowlade3dontbraganme3ortekarnal4startekspektnmorframme$24 125,81,02,130,R81,02,A45,81,01,A35, 5,12, You don't have to say that, sir. I shouldn't have let them get Paladin. yudonthavtusatat2sarp5isudnthavlattamgatpaladan A45,81,05,R435,81,03,450,81,02, It happens, $C. It's part of war. ithapns2lutanant4atspartafwar A45,81,03,A35,R81,05,435,81,04,440, 11, Ran into a few hairballs, I hear. ranantuafuharbals3iher RA45,81,01,A35,81,01,A50,81,02, Yes, sir. The locations were autologged in the flight recorder. yesr3telocatanswarawtolagdanteflitcamputr 425,81,04,415,81,02,RA45,81,01,A35, $11, At least you made all the Nav Points. atlesyumadaltenavpunts RA45,81,01,A35,81,01,A50,81,02, Your recon will be very useful. yurrekanwalbevareusfal RA15,81,01,A15,81,01,A10,81,02, 12, I've already sent out another patrol to check the jump points you missed. ivalradesanowtanatrpatroltujektejampuntsyumasd A15,R645,81,01,655,81,01,650,81,01, So let's go over the mission report. solatsgoovrtemisnreport RA45,81,01,A35,81,01,450,81,02, 14, You skragged $K Kilrathi, $C... yuskragdsevnkalrate3dipstik 15, I see no kills for you, $C... isenokalsforyu2dipstik 16, and Paladin did in $L himself. adpaladandadansevnhamsef 17, and Paladin came up empty. adpaladancamapamte 5,18, And we lost Paladin. adwelastpaladan RA45,81,01,A35,81,01,A50,81,02, 19, I want to see you in my office after you've had a shower, $C. addipstik4iwanttuseyuanmiafisanacaplafowrs RA45,81,01,A35,81,01,A50,81,02, That's all, then. Dismissed. tatsalten4dasmasd 2 ' 2 a 2 2 D2 deF 4V vw vw That's Iceman and Knight over there. tatsismanadnitovrtar 245,R81,02,A45,81,01,A35,81,01,A50, Knight's a darned reliable pilot... nitsadarndrela2blpilat RA45,81,01,A35,81,01,A50,81,02, a solid shot, a steady flier. asaladsat5astadefliar RA45,81,01,A35,81,01,A50,81,02, Not flashy at all ... He's sort of a craftsman. Gets the job done, though. natflaseatal8hessortafacrafsman5gatstejabdan2to A45,81,01,A35,R81,01,240,81,01,A50, Iceman, though, now he's an artist. isman3to3nowhesanartast 235,R81,01,A35,81,01,A50,81,02, Best pilot on the Tiger's Claw. bespilatantetigrscla RA45,81,01,A35,81,01,A50,81,02, Lives to fly and to fight. He's totally ruthless, and completely deadly. lavstufliadtufit8hestotalerutlas4adcampletledadle RA45,81,01,A35,81,01,A50,81,02, Some of the pilots say he's got freon for blood... samaftepilatssahesgatfreanforblad RA45,81,01,A35,81,01,A50,81,02, ...at least, that's where he got the call sign. atlesttatswarhegattecalsin RA45,81,01,A35,81,01,A50,81,02, 2 5 Z 2 z 2 c U yz2 U2 U $C, right? I'm Knight. Welcome to the Blue Devils. dipstik2rit5imnit3walcamtutebludavls RA45,81,01,A35,81,01,A50,81,02, Ever flown Scimitars before? I think you're going to like them. avrflownsamatarsbefor5itikyurgoagtuliktem RA45,81,01,A35,81,01,A50,81,02, A Scimitar isn't quite as fast or nimble as a Hornet... asamatarasnkwitasfasarnamblasahornat RA45,81,01,A35,81,01,A50,81,02, ...but she's got twice the armor, as well as heavier guns. batsesgattwistearmraswalashaver RA45,81,01,A35,81,01,A50,81,02, And she handles like a Centaurian mud pig. avrflownsamatarsbefor5itikyurgoagtuliktem 245,81,01,235,R81,01,A50,81,02,A35, Iceman here'll try to tell you speed and handling'll save your butt... ismanherltritutalyuspedadhadlaglsavyurbat 140,81,01,RA45,81,01,A35,81,01, ..but I'll take an extra three centimeters of durasteel plating any day batiltakanakstrtreanjsafdurastelplataganeda RA45,81,01,A35,81,01,A50,81,02, 0 P Q l 2 P pqF 9 $C. They call me Iceman. dipstik8tacalmeisman RA45,81,01,A35,81,01,A50,81,02, Don't let Knight fool you. dontlatnitfulyu RA45,81,01,A35,81,01,A50,81,02, The Scimm's a gun-heavy slug. tesamsatsaganhaveslag RA45,81,01,A35,81,01,A50,81,02, Forget finesse ... just head straight in, guns blaring. forgatfanasp6jashadstratan4gansblarag RA45,81,01,A35,81,01,A50,81,02, Give me a ship that takes skill... gavmeasaptatakskal RA45,81,01,A35,81,01,A50,81,02, A Raptor, even a Hornet... araptor3evnahornat RA45,81,01,A35,81,01,A50,81,02, ...or one of those new Rapiers... orwanaftosnurapearsavrewanstakagabowt RA45,81,01,A35,81,01,A50,81,02, If half of what they say is true, the Rapier's a true artist's ship afhafafwattasaastru5terapearsatruartastssip RA45,81,01,A35,81,01,A50,81,02, S H R m S 4 5 6 7 r F F 0u F ? P ij P 5 F F N P F ,3s P P mF x ,Z , F - .mn op Mission Briefing.McAuliffe System, $T hours, $D. Well, boys and girls, things are getting ready to heat up. walbusadgrls3tagsargatagradetuhetap The Confederation is getting ready to mount a major offensive... tecanfadaratanasgatagradetumownamajrafansiv RA45,81,01,235,81,01,A50,81,02,135,81,01, ...so we're expecting several supply ships within the next 48 hours. sowerakspactagsavralsaplisapswatantenaksforteathowrs RA45,81,01,235,81,01,A50,81,02,135,81,01, But scanners show increased Kilrathi activity in this system. batskanrssoancresdkalrateaktavateantassastm RA45,81,01,235,81,01,A50,81,02,135,81,01, We've got to clean up the enemy presence here at McAuliffe... wevgattuclenapteanameprasnsheratgatwa RA45,81,01,135,81,01,A50,81,02,240,81,01, ...before the tankers and 'sports start to arrive tomorrow. befortetankrsadsportsstarttuarivtumaro RA45,81,01,135,81,01,A50,81,02,240,81,01, We've detected a large bogie about 90,000 klicks out. wevdetaktdalarjbogeabowtnintetowsndkliksowt RA45,81,01,A35,81,01,A50,81,02, It jumped in about 20 minutes ago, and seems to be headed this way. atjampdanabowttwanemanatsago3adsemstubehadadtaswa RA45,81,01,A35,81,01,A50,81,02, It might be just a transport, but it's probably a small warship. atmitbejasatankr5batatsprabbleasmalwarsip RA45,81,01,A35,81,01,A50,81,02, 5,11, $C, you and Paladin are going to go out and get a look at it... dipstik3yuadpaladanargoagtugoowtadgatalukatat RA45,81,01,A35,81,01,A50,81,02, 5,12, $C, I want you to go out and get a look at it... dipstik4iwanyutugoowtadgatalukatat RA45,81,01,A35,81,01,A50,81,02, ...and destroy it if you can. addestruatafyucan RA45,81,01,A35,81,01,A50,81,02, 5,14, Faith, lad, but that'll be a challenge... fat2lad4battatlbeajalaj RA5,81,01,135,81,01,A30,81,02, Here's your flight plan... hersyurflitplan If the bogie continues its present course and speed... A45,81,01,A35,81,01,R250,81,02, ...you should meet it here, at Nav 1. We've detected a fighter escort in the area as well... ...so be on the lookout for additional bogies. sobeantelukowtforadatanalboges The colonel quickly goes through the rest of the assignments, dispatching other wings to check out other bogies in the system. Squadron dismissed. $ 2 , I J P F F 78z F ; bv 6d F z Y F KLj '2L afF F kF F u u Mission debriefing. $T hours, $D. 1,6, Nice job, $C. nisjab2dipstik 5,4, You too, Paladin. Congratulations to the both of you. yutu2paladan4cangrajulatanstutebotafyu The kid did all the work, sir. I was just along for the ride. tekadadaltewarksr3iwasjasalagfarterid A45,81,01,A35,R81,02,250,81,01,235, Those Kilrathi destroyers really aren't much to worry about, sir. tekalratecorvatsrelearntmujtuwareabowt2sar 225,81,02,230,R81,02,A45,81,01,A35, I don't know, $C. They had you outgunned as well as outnumbered. idontno3lutanant6tahadyuowtgundaswalasowtnambrd A45,81,05,RA35,81,03,A50,81,02, 1,12, Didn't get her, eh? didntgathar2a4 A45,81,03,A35,R81,05,A35,81,04,A40, No, sir. I'm sorry. nosar4imsare RA45,81,01,A35,81,01,A50,81,02, 1,9, Well, no matter. You got close enough for your computer to make her. wal3nomatr5yugatclosenafforyurcamputrtumakher RA45,81,01,A35,81,02, We've already downloaded your recon from your flight recorder. wevalradedownlodedyurrecanframyurflitcamputr RA45,81,01,A35,81,01,A50,81,02, 1,11, Too bad you didn't get closer ... we could have used a positive ID on her. tubadyudidntgatclosr10wecudhavusdapasatavideanhar RA45,81,01,A35,81,01,A50,81,02, I dispatched a squadron of Raptors to intercept. She won't get past them. idispajdaskwadranafraptorstuintrsept6sewontgatpastem RA15,81,01,A15,81,01,A10,81,02, Now, to review the mission... now4turevutemisn RA45,81,01,A35,81,01,450,81,02, 14, Recorder shows you killed $K, $C... reportsosyukilt2dipstik 15, Recorder shows no kills for you, $C... reportsosnokalsforyu2dipstik 5,18,16, and $L killed by Paladin. adfivkalsforpaladan 17, and none for Paladin. adnanforpaladan 5,18, And Paladin didn't make it back. adpaladandidnmakatbak A45,81,01,A35,81,01,R435,81,02, 1,20, By the way, we've identified the big bogie as a Ralari-class destroyer. bytewa4wevidantafidtebagbogeasaspakereclascorvet RA45,81,01,A35,81,01,A50,81,02, 1,20, Good job taking her out. gudjabtakagharowt RA45,81,01,A35,81,01,A50,81,02, 21, And $C ... I want to see you in my office in an hour. addipstik4iwanttuseyuanmiafisananowr RA45,81,01,A35,81,01,A50,81,02, That's all. Dismissed. tatsalten4dasmasd - J n o F 9d F 'HF A A 45wF F You met Maniac and Bossman over there yet? yumatmaniakadbasmanovrtaryat 245,R81,02,A45,81,01,A35,81,01,A50, Maniac's a real lunatic...a good pilot, but way too erratic. maniaksarellunatac9agudpilat4batwatuaratac RA45,81,01,A35,81,01,A50,81,02, He was just comin' up when the fleabags put me outa commission. hewasjascamagapastaflebagspatmeowtacamasan RA45,81,01,A35,81,01,A50,81,02, Just between you and me, I'd rather fly alone than with Maniac on my wing. jasbetwenyuadme4idrathrflialontanwatmaniakanmiwag A45,81,01,235,R81,01,240,81,01,A50, Bossman's another story, though. basmansanathrstore3tho 235,R81,01,A35,81,01,A50,81,02, He's a real team leader. hesareltemledr RA45,81,01,A35,81,01,A50,81,02, A crack pilot, with 17 years behind him. akrakpilat4watsavntenyersbehidham RA45,81,01,A35,81,01,A50,81,02, Flown ever'thin' in the Terran fleet... flownavretagantetaranflet RA45,81,01,A35,81,01,A50,81,02, and blown up at least one of every class the Kilrathi have. adblonapatleswanafavreclastekalratehav RA45,81,01,A35,81,01,A50,81,02, K i A A A uK 2 P7 2 a2 F 9T tuF F Sit down, $C. They call me Bossman. I've been watching you. sitdown2dipstik5tacalmebasman5ivbanwajagyu RA45,81,01,A35,81,01,A50,81,02, You look good for a rookie. yulukgud7foraruke RA45,81,01,A35,81,01,A50,81,02, You handle yourself well in a dogfight... yuhadlyursafwalanadagfit RA45,81,01,A35,81,01,A50,81,02, ...but we're going to be facing some bigger ships soon. batwergoagtubefasagsambagrsapssun RA45,81,01,A35,81,01,A50,81,02, All right Some serious action alrit4samsereasaksan$50 RA15,81,01,A20,81,01, A lot of young pilots get excited when they see their first destroyer... alatafyagpilatsgataksitadwantasetarfarscorvat RA45,81,01,A35,81,01,A50,81,02, Just what do you mean by that, Boss? jaswatduyumenbitat3bas R215,81,01,225,81,01,220,81,02, ...they lose their heads and go straight in for the battleship. thalustarhadsadgostratanfortebatlsap 140,R81,02,A45,81,01,A35,81,01,A50, Then a light fighter they forgot about blasts them from behind. tanalitfitrtaforgatabowtblatstamframbehid RA45,81,01,A35,81,01,A50,81,02, Big ships move slow and turn like pigs. bagsapsmuvsloadtarnlikpigs RA45,81,01,A35,81,01,A50,81,02, Thing to do is clean up the fighter cover first... tagtuduasclenaptefitrcavrfars RA45,81,01,A35,81,01,A50,81,02, ...then go in for the battleship. tangoanfortebatlsap RA45,81,01,A35,81,01,A50,81,02, - G - g h - 12y- J jkK K Hey, $C. I'm Maniac. Glad to meetcha. ha2dipstik5immaniak4gladtumeja RA15,81,01,A25,81,01,A30,81,02, Bossman says we're gonna see some action against some battleships soon. basmansaswergunasesamaksanaganssambatlsapssun$99 220,R81,01,A15,81,01,A20,81,02, I can't wait... ikantwat R81,01,A15,81,01,A20, Dodging flak and fighter cover to make a missile run at a destroyer... dajagflakadfitrcavrtumakamislranatadestruar RA25,81,01,A15,81,01,A20,81,02, Man, that'll be a rush ma3n4tatlbearas R81,01,A15,81,01,A20, Get in there quick, waste the mama cat... gatantarkwik4wasttematrdak RA15,81,01,A25,81,01,A20,81,02, ...then pick the kittens off one by one. tanpaktedaklagsafwanbiwan R81,01,A25,81,01,A10, That's the way to do it tatstewatuduat RA15,81,01,A25,81,01,A20,81,01, S e A 4 5 Z 6 7 l P Z .Q P P Q P D P EKv ,,HIwJK P T Z Z ?i2 jk Z P Mission Briefing.McAuliffe System, $T hours, $D. We're going to be leaving McAuliffe late tomorrow... wergoagtubelevaggatwalattumaro but first, we've got a half-dozen 'sports and tankers coming in. batfars5wevgatahafdaznsportsadtankrscamagan With at least one Kilrathi carrier in the system, watatlestwankalratecarearantesactr RA45,81,01,235,81,01,A50,81,02,135,81,01, ...we're expecting the hairballs to make a play for most of the 'sports. werekspektagteharbalstumakaplaformosaftesports RA45,81,01,235,81,01,A50,81,02,135,81,01, Here are the assignments for transport escorts... herarteasinmatsfortransportadtankraskorts RA45,81,01,135,81,01,A50,81,02,240,81,01, The colonel makes the assignments for the wings.You draw the final run... 5,8, $C and Paladin will take the last detail. dipstikadpaladanwaltaktelasdetal 5,9, $C, you'll be flying the last detail solo. dipstik3yulbefliagtelasdetalsolo Computer, display Psi. camputer4diplaipsi You'll rendezvous with a Drayman-class tanker here, at Nav 1. As soon as it arrives, the tanker will head for the Tiger's Claw. It'll be moving at top speed, and won't deviate from its shortest course... So you'll have to protect it from any attackers. soyulhavtuprotaktatframaneatakrs RA50,81,01,135,81,01,A30,81,02, Stay close ... don't let enemy fighters draw you away from the tanker. satclos7donlatanamefitrsdrayuawaframtetankr RA50,81,01,135,81,01,A30,81,02, Now, one more thing, boys and girls... now2wanmortagbusadgrls A45,81,01,A35,81,01,R250,81,02, Intelligence indicates Bhurak Starkiller may be in the system. antalagansandacatskajatefagmabeantesastam Bhurak Starkiller, sir? kajatefag3sar RA50,81,01,A35,81,01,A30,81,02, He's one of Kilrah's best ... flies a Salthi light fighter. heswanafkalrasbast4flisakranhavefitr Our records credit him with 64 kills, counting fighters and battleships. owrracordscradathamwatsikstyforkills5cowntagfitrsadbatlsips So let's all be extra careful out there, alright? Squadron dismissed. $ 1 z F BZ P ?F P Z F P tu 2 P F HMn 8F 9nP F 'Q qvd d Mission debriefing. $T hours, $D. 2,6,5,2, Well done, gentlemen. The tanker commander asked me to commend you both. waldan3jantlman5tetankrcamandraskdmetucamandyubot 5,3, Good work out there, $C. The tanker skipper asked me to thank you. gudwrkowttar2dipstik5tetankrskipraskdmetutankyu R81,01,A35,81,02,A45, 3,4, And my personal congratulations for dispatching Bhurak Starkiller. admiprsanalcangrajulatansfordaspajagburaktarkilar R81,01,A35,81,02,A45, I'm just glad to get that 'sport back to the Claw, sir. imjasgladtugattatfulbaktutecla3sar R81,01,A35,81,02,A45, 5,12, Now, don't go discountin' the fun in givin' the hairballs a black eye, lad. now3dontgodascowntntefanangavnteharbalsablaki3lad A45,R81,02,135,81,03,150, 2,12, So we lost the tanker, $C? That's going to cost all of us, you know. sowelastetankr2dipstik4tatsgoagtocastalafas3yuno A45,81,03,A35,R81,05,A35,81,04,A40, I know, sir. But there were just too many enemy fighters... ino2sar4battarwarjastumaneanamefitrs RA45,81,01,A35,81,01,A50,81,02, 5,9, Paladin and I couldn't handle all of them at once... paladanadicudnthandlalaftematwans RA45,81,01,A35,81,02, I understand, son, but we were too short-handed to send two wings. iandrstan2san3batwewartusorthadedtusantuwags RA45,81,01,A35,81,01,A50,81,02, If we're going to win this war... afwergoagtuwantaswar RA45,81,01,A35,81,01,A50,81,02, ...we're all going to have to do the work of three men. weralgoagtuhavtudutewarkaftreman RA15,81,01,A15,81,01,A10,81,02, Enough of that, though. Let's review the mission... enafaftat2to5latsrevutemasn RA45,81,01,A35,81,01,450,81,02, 14, You racked up $K Kilrathi, $C... yurakdaptrekals2dipstik 15, No kills for you, $C... nokalsforyu2dipstik 5,18,16, and Paladin got $L of the hairballs. adpaladangatfivafteharbals 17, and Paladin came up empty. adpaladancamapamte 5,18, We lost Paladin out there. welaspaladanowttar A45,81,01,A35,81,01,R435,81,02, 3,20, And you shot down Bhurak Starkiller... adyushatdownkajatefag RA45,81,01,A35,81,01,A50,81,02, Everything else aside, $C, that was excellent work. avaretagalsasid2dipstik3tatwasaksalenwark RA45,81,01,A35,81,01,A50,81,02, 21, And I want to see you in my office later, $C. adiwantuseyuanmiafaclatr2dipstik Dismissed. dasmasd ? F c i F ;AF F Xv Cc2 8S 8S Hey there, $C. Get you somethin'?. haytir3dipstik4getusomtin 245,R81,02,A45,81,01,A35,81,01,A50, 5,3, I'm glad to see you and Paladin gettin' along so well. imgladtoseuanpaladangetinalongsowel RA45,81,01,A35,81,01,A50,81,02, He'll be retirin' soon, you know?. helberetirnsun3uno RA45,81,01,A35,81,01,A50,81,02, 5,5, I'm glad to see you and Paladin were getting along so well. imgladtoseuanpaladanwirgetingalongsowel RA45,81,01,A35,81,01,A50,81,02, He was s'posed to retire soon, you know? hewassuposedtoretirsun3uno RA45,81,01,A35,81,01,A50,81,02, Been flyin' fighters for twenty-odd years... binflingitersfortwenteahdyirs A45,81,01,A35,R81,01,240,81,01,A50, 5,7, ...and now they're puttin' him out to pasture. annowthirputinhimowttopastir 235,R81,01,A35,81,01,A50,81,02, 5,8, ...and he buys it a month before his retirement. anhebisitamanthbeforhasretirmen 235,R81,01,A35,81,01,A50,81,02, He and I used to fly together back before the war started. hesaniusetoflitogetherbakbeforthewarstarted RA45,81,01,A35,81,01,A50,81,02, Darn good man ... the old Claw'll miss him. darngudman4theolclalmishim A45,R81,01,435,81,01,440, 2 X F x y F ABz 2 4 TZ2 F IJF IJ $C, sit down. I want to compare notes with you. dipstik2satdown3iwantucamparnotswatyu RA45,81,01,A35,81,01,A50,81,02, I've been watching the way Dralthi maneuver... ivbenwajagtewadraltemanuvr RA45,81,01,A35,81,01,A50,81,02, ...and I think I've noticed something. aditankivnotisdsamtag RA45,81,01,A35,81,01,A50,81,02, Seems to me that when you're hot on a Dralthi's tail... semstumetatwanyurhatanadraltistal RA45,81,01,A35,81,01,A50,81,02, ...and he pulls a loop to shake you... adhepalsaluptusakyu RA45,81,01,A35,81,01,A50,81,02, ...he always goes up or down, never to the side. Ever notice that? healwasgosapordown3navrtutesid7evrnotastat RA45,81,01,A35,81,01,A50,81,02, You shrug in tenative agreement R81,02,A35, Well, they do ... always up or down, never left or right. wal3tadu6alwasapordown4nevrlaforrit RA45,81,01,A35,81,01,A50,81,02, 5,9, Y'know, lad, I believe you're right. yano2lad3itankyurrit RA45,81,01,A35,81,01,A50,81,02, I think it's because those big wings block their vision to the sides... itankatsbecaztosbagwagsblaktarvazantutesids RA45,81,01,A35,81,01,A50,81,02, ...but above and below -- between the wings -- their vision is clear. batabavadbelo3betwentewags5tarvazanascler RA45,81,01,A35,81,01,A50,81,02, ; F KF kl EF efF 9 YZF Z 0uZ 0u I'd like ta tell ya, laddy, s'been good flyin' with you. idliktatalya2lade4sbangudfliagwatya RA45,81,01,A35,81,01,A50,81,02, We'll be pullin' outa McAuliffe soon... welbepalanowtagatwasun 235,R81,01,A35,81,01,A50,81,02, ...an' the colonel likes to shake up the wings every now an' then. antekarnallikstusakaptewagsavrenowanten RA45,81,01,A35,81,01,A50,81,02, So let me give you one last piece of advice... solatmegavyuwanlaspesafadvis RA45,81,01,A35,81,01,A50,81,02, ...a young wingman ain't goin' ta stick by you the way I have, lad. ayugwagmanantgoantastakbiyatewaihav2lad RA45,81,01,A35,81,01,A50,81,02, That's no criticism of 'em, lad, just a fact. tatsnocratasasmafam2lad3jasafakt RA45,81,01,A35,81,01,A50,81,02, A youngster's got a name to make and a career to think on... ayagstersgatanamtumakadacarertutankan RA45,81,01,A35,81,01,A50,81,02, ...'e'll be lookin' to make a hero of 'imself. helbelukantumakaheroafhamsef RA45,81,01,A35,81,01,A50,81,02, An old man like meself, on the other hand... anoldmanlakmisefanteatrhan RA45,81,01,A35,81,01,A50,81,02, well, I'm just wantin' to make it back so I can retire in one piece. wel4imjaswantntumakatbaksoicanretiranwanpes 445,81,02,430,R81,02,A45,81,01,A35, F q k 2 3 Z 4 5 d F P 1d Z ef ;S stF ,, Z , wD F EFp P F 4 TU d d Mission Briefing. Gateway System, $T hours, $D. Welcome to the Gateway System, boys and girls. walkamtutemakalefsastm3busadgrls These are the assignments for preliminary patrols... tesarteasinmansforprelamanarepatrols The commander quickly makes the assignments for Alpha, Beta, and Gamma wings. tecamandrkwiklemaksteasinmansforalfabataadgamawags Delta wing. That'll be you flying lead, $C. daltawag5tatlbeyufliagled3jezwiz RA45,81,01,A35,81,01,A50,81,02, Paladin, you'll be flying wingman. RA45,81,01,A35,81,01,A50,81,02, An' a pleasure it'll be, colonel. anaplasuratlbekarnal$99 RA45,81,01,A35,81,01,A50,81,02, Right. rit 135,81,01,140,R81,01,A45, Computer, display Delta. camputr3daspladalta You'll follow a simple three-point route, gentlemen. yulfaloasampltrepuntrut3jantlman Just fly to the Nav Points, and make sure they're clear. jasflitutenavpunts3admaksurthardcler We're picking up some debris around Nav Point 1. werpakagapsamdabrearownnavpunt1 Probably just asteroids, but it could be a Kilrathi mine field..., prabablejasastruds4batatcudbeakalrateminfeld ...so be especially careful in that area. sobeaspaslecarfalantatarea RA5,81,01,135,81,01,A30,81,02, Questions? kwastans RA45,81,01,135,81,01,A50,81,02, Alright, then. Epsilon wing is Iceman and Angel... alritten3apsalanwagasismanadangl A45,81,01,A35,81,01,R250,81,02, You listen as the colonel completes the mission assignments. That's everyone. Last questions? tatsavrewan4laskwastans No hands are raised. Good. Let's get to work. Squadron dismissed. $ F - E Y Z F DEK 9 U YZy K K c P P 'Rq K U ,UpA A A 6OA PUpK K Vd vwd vw Mission debriefing. $T hours, $D. 30,7, Good job out there, $C. gudjabowttar3jezwiz You made it look like you been at this for years. yumadatluklikyubanattassforyers RA45,81,01,A35,81,01,A50,81,02, 5,5, I wasn't half as smooth as Paladin here, sir. iwasnhafassmutaspaladanher3sar A45,81,01,A35,R81,02,250,81,01,235, Now laddy, don't brag on me, or the colonel'll start expectin' more from me nowlade3dontbraganme3ortekarnal4startekspektnmorframme 125,81,02,130,R81,02,A45,81,01,A35, 5,7, Thank you, sir. I'm sorry about Paladin. tankyusar4imsareabowtpaladin A45,81,05,R435,81,03,450,81,02, It happens, $R Get used to it. ithapns2lutanant4gatustuat A45,81,03,A35,R81,05,435,81,04,440, 30,9, Met some fuzzballs out there, eh? matsamfazbalsowttar2a RA45,81,01,A35,81,01,A50,81,02, Yes, sir. I've already transferred their coordinates to the main computer. yesr3ivalradetransfardtarlocatanstutemankamputr RA45,81,01,A35, 2,11, Looks like we've got a serious Kilrathi presence here. lukslikwevgatasereaskalrateprasansher RA45,81,01,A35,81,01,A50,81,02, Tactical will be glad to get your report. taktaklwalbegladtugatyurreport RA15,81,01,A15,81,01,A10,81,02, 2,12, I've already dispatched a wing to survey the Nav Points you missed. ivalradedispajdawagtusarvatenavpuntsyumisd A15,R645,81,01,655,81,01,650,81,01, I reviewed your mission report upstairs. irevudyurmasnreportapstars RA45,81,01,A35,81,01,450,81,02, 14, You skragged $K Kilrathi, $C... yuskragdsevnkalratefitrs3dipstik 15, I saw no kills for you, $C... isanokalsforyu2dipstik 16, and Paladin did in $L himself. adpaladandadansevnhamsef 17, and Paladin came up empty. adpaladancamapamte 5,18, And the hairballs got Paladin. adteharibalsgatpaladan RA45,81,01,A35,81,01,A50,81,02, 19, Oh, and $C, I want to see you in my office after you've cleaned up. o2adjezwiz4iwantuseyuanmiafazaftryuvclendap RA45,81,01,A35,81,01,A50,81,02, That's all, then. Dismissed. tatsalten4dasmasd A ' A a A A K D7 de 4VZ vwZ vw That's Iceman and Knight over there. tatsismanadnitovrtar 245,R81,02,A45,81,01,A35,81,01,A50, Knight's a darned reliable pilot... nitsadarndrela2blpilat RA45,81,01,A35,81,01,A50,81,02, a solid shot, a steady flier. asaladsat5astadefliar RA45,81,01,A35,81,01,A50,81,02, Not flashy at all ... He's sort of a craftsman. Gets the job done, though. natflaseatal8hessortafacrafsman5gatstejabdan2to A45,81,01,A35,R81,01,240,81,01,A50, Iceman, though, now he's an artist. isman3to3nowhesanartast 235,R81,01,A35,81,01,A50,81,02, Best pilot on the Tiger's Claw. bespilatantetigrscla RA45,81,01,A35,81,01,A50,81,02, Lives to fly and to fight. He's totally ruthless, and completely deadly. lavstufliadtufit8hestotalerutlas4adcampletledadle RA45,81,01,A35,81,01,A50,81,02, Some of the pilots say he's got freon for blood... samaftepilatssahesgatfreanforblad RA45,81,01,A35,81,01,A50,81,02, ...at least that's where he got the call sign. atlesttatswarhegattecalsin RA45,81,01,A35,81,01,A50,81,02, 5 Z z F 6UF uvF A aA hA h $C, right? I'm Knight. Welcome to the Killer Bees. dipstik2rit5imnit3walcamtutebludavls RA45,81,01,A35,81,01,A50,81,02, You're flying a Hornet right now, right? Ever flown a Scimitar? yurfliagaharnatritnaw2rit4avrflownsamatar RA45,81,01,A35,81,01,A50,81,02, It isn't quite as fast or nimble as a Hornet... atasnkwitasfasarnamblasahornat RA45,81,01,A35,81,01,A50,81,02, ...but she's got twice the armor, as well as heavier guns. batsesgattwistearmraswalashaver RA45,81,01,A35,81,01,A50,81,02, And she handles like a Centaurian mud pig. anshehandlslikasintareanmudpig 245,81,01,235,R81,01,A50,81,02,A35, Iceman here'll try to tell you speed and handling'll save your butt... ismanherltritutalyuspedadhadlaglsavyurbat 140,81,01,RA45,81,01,A35,81,01, ..but I'll take an extra three centimeters of durasteel plating any day batiltakanakstrtreanjsafdurastelplataganeda RA45,81,01,A35,81,01,A50,81,02, F 0 P Q l 2 P pqF 92 2 $C. They call me Iceman. dipstik8tacalmeisman RA45,81,01,A35,81,01,A50,81,02, Don't let Knight fool you. dontlatnitfulyu RA45,81,01,A35,81,01,A50,81,02, The Scimm's a gun-heavy slug. tesamsatsaganhaveslag RA45,81,01,A35,81,01,A50,81,02, Forget finesse ... just head straight in, guns blaring. forgatfanasp6jashadstratan4gansblarag RA45,81,01,A35,81,01,A50,81,02, Give me a ship that takes skill... gavmeasaptatakskal RA45,81,01,A35,81,01,A50,81,02, A Raptor, even a Hornet... araptor3evnahornat RA45,81,01,A35,81,01,A50,81,02, ...or one of those new Rapiers... orwanaftosnurapearsavrewanstakagabowt RA45,81,01,A35,81,01,A50,81,02, If half of what they say is true, the Rapier's a true artist's ship afhafafwattasaastru5terapearsatruartastssip RA45,81,01,A35,81,01,A50,81,02, 2 b 4 5 6 7 q Z r s Z 9 P ;q P $ . OPrs P P KL Emergency Briefing.Gateway System, $T hours, $D. We've got a Code Red alert, people. wegatacodradalrt3pepl At least half a dozen Kilrathi fighters, coming in fast. atleshafadazankalratfitrs3camaganfast With Blue Devil and Star Slayer squadrons out on patrol... watbludavladstarslaarskwadransowtanpatrol ...you Killer Bees will have to stop them yourselves. yukalrbeswalhavtustaptamyurselvs RA45,81,01,235,81,01,A50,81,02,135,81,01, We've got two Hornets in space already... wevgattuhornatsanspasalrade RA45,81,01,135,81,01,A50,81,02, ...and we'll scramble the remaining wings at double-time. adwelskramblteremanagwagsatdabltim RA45,81,01,A50,81,02,240,81,01, 5,8, $C, you and Paladin will be first out the launch tube. RA45,81,01,A35,81,01,A50,81,02, 5,9, $C, you'll be first out the launch tube. RA45,81,01,A35,81,01,A50,81,02, Iceman and Dragon will be next... RA45,81,01,A35,81,01,A50,81,02, ...followed by Bossman and Redbird. RA45,81,01,A35,81,01,A50,81,02, Remember, people, this is for all the marbles... remambr3pepl4tasasforaltemarbls RA45,81,01,A50,81,02,240,81,01, Stop these fighters, or you'll have no place to land staptesfitrs4oryugatnoplastulad RA45,81,01,135,81,01,A50,81,02, So let's get to it solatsgattuat RA45,81,01,A35,81,01,A50,81,02, Squadron dismissed $ 2 - A S 2 T Z A 7K A 1 F QYP F 'e U P ? P Gdy K A 87 9xA y7 K U IN Mission debriefing. $T hours, $D. 25,6, Excellent work, $C. aksalanwrk3jezwaz 5,4, You too, Paladin. Congratulations to the both of you. yutu2paladan4cangrajulatanstutebotafyu A45,81,05,RA35,81,03,A50,81,02, You might say I was inspired ta a great effort, Colonel. yumitsaiwasanspirdtaagratafort2kernal A45,81,01,A35,R81,02,250,81,01,235, I just did what had to be done, sir. ijasdadwathadtubedan2sar 225,81,02,230,R81,02,A45,81,01,A35, You fought off the Dralthi before we could even launch the next wing yufowtaftedraltebeforwecudevanlanjtenekswag A45,81,05,RA35,81,03,A50,81,02, 25,13, Welcome back, $C. Looks like we all came through it. walkambak3jezwizlukslakwealcamtruat A45,81,03,A35,R81,05,A35,81,04,A40, How's the Tiger's Claw, sir? howstetigrskla3sar RA45,81,01,A35,81,01,A50,81,02, We took considerable damage, especially to the flight decks. wetukcansadrabldamaj5espesaletuteflitdaks RA45,81,01,A35,81,02, One hit blocked the launch tubes just before Iceman and Dragon launched. wanhatblakdtelanjtubsjasbeforismanaddraganlanjd RA45,81,01,A35,81,01,A50,81,02, That's why we couldn't get anyone out there to back you up. tatswiwecudntgatanewanowttartubakyuap RA45,81,01,A35,81,01,A50,81,02, That's all right, sir. At least we all lived though it. tatsalrit2sar5atlukslikweallavdtruat RA45,81,01,A35,81,01,A50,81,02, 5,13, All except Paladin, that is. alekseppaladan3atles A45,81,01,R435,81,01,450,81,02, We've already gotten a mission report. wevalradegatamasnreport RA45,81,01,A35,81,01,450,81,02, 15, It shows you took out $K, $C... atsosforkalsforyu2dipstik 16, It shows no kills for you, $C... atsosnokalsforyu2dipstik 5,19,17, and $L for Paladin. adfivkalsforpaladan 18, and none for Paladin. adnanforpaladan 5,19, And Paladin didn't make it back, of course. adpaladandidnmakatbak3afcors A45,81,01,A35,81,01,R435,81,02, 20, And $C ... I want to see you in my office in an hour. addipstik4iwanttuseyuanmiafisananowr RA45,81,01,A35,81,01,A50,81,02, That's all. Dismissed. tatsalten4dasmasd A - H ? l m A 7A 2 U2 uvA A SmZ Z You met Maniac and Bossman over there yet? yumatjokradbasmanovrtaryat 245,R81,02,A45,81,01,A35,81,01,A50, Maniac's a real lunatic...a good pilot, but way too erratic. jokrsarellunatac9agudpilat4batwatuaratac RA45,81,01,A35,81,01,A50,81,02, He was just comin' up when the fleabags put me out of commission. hewasjascamagapastaputmeowtofcamisin RA45,81,01,A35,81,01,A50,81,02, Just between you and me, I'd rather fly alone than with Maniac on my wing. jasbetwenyuadme4idrathrflialontanwatjokranmiwag A45,81,01,235,R81,01,240,81,01,A50, Bossman's another story, though. basmansanathrstore3tho 235,R81,01,A35,81,01,A50,81,02, He's a real team leader. hesareltemledr RA45,81,01,A35,81,01,A50,81,02, A crack pilot, with 17 years behind him. akrakpilat4watsavntenyersbehidham RA45,81,01,A35,81,01,A50,81,02, Flown everything in the Terran fleet... flownavretagantetaranflet RA45,81,01,A35,81,01,A50,81,02, and blown up at least one of every class the Kilrathi have. adblonapatleswanafavreclastekalratehav RA45,81,01,A35,81,01,A50,81,02, A i K A A u- Z- F Ce K XA xy Sit down, $C. They call me Bossman. I've been watching you. sitdown2dipstik5tacalmebasman5ivbanwajagyu RA45,81,01,A35,81,01,A50,81,02, You look good for a rookie. yulukgud7foraruke RA45,81,01,A35,81,01,A50,81,02, You handle yourself well in a dogfight... yuhadlyursafwalanadagfit RA45,81,01,A35,81,01,A50,81,02, ...but we're going to be facing some bigger ships soon. batwergoagtubefasagsambagrsapssun RA45,81,01,A35,81,01,A50,81,02, All right Some serious action alrit4samsereasaksan$99 RA15,81,01,A25,81,01,A20,81,01, A lot of young pilots get excited when they see their first destroyer... alatafyagpilatsgataksitadwantasetarfarsdestroer RA45,81,01,A35,81,01,A50,81,02, Just what do you mean by that, Boss? jaswatduyumenbitat3bas R225,81,01,215,81,01,220,81,02, ...lose their heads and go straight in for the battleship. lustarhadsadgostratanfortebatlsap 140,R81,02,A45,81,01,A35,81,01,A50, Then a light fighter they forgot about blasts them from behind. tanalitfitrtaforgatabowtblatstamframbehid RA45,81,01,A35,81,01,A50,81,02, Big ships move slow and turn like pigs. bagsapsmuvsloadtarnlikpigs RA45,81,01,A35,81,01,A50,81,02, Thing to do is clean up the fighter cover first... tagtuduasclenaptefitrcavrfars RA45,81,01,A35,81,01,A50,81,02, ...then go in for the battleship. tangoanfortebatlsap RA45,81,01,A35,81,01,A50,81,02, A E 7 e f 2 7 9- 4O2 ef Hey, $C. I'm Maniac. Glad to meetcha. ha2dipstik5imjokr4gladtumeja RA25,81,01,A15,81,01,A30,81,02, Bossman says we're gonna see some action against some battleships soon. basmansaswergunasesamaksanaganssambatlsapssun$99 225,R81,01,A15,81,01,A30,81,02, I can't wait... ikantwat RA25,81,01,A15,81,01,A20,81,02, Dodging flak and fighter cover to make a missile run at a destroyer... dajagflakadfitrcavrtumakamislranatadestruar R81,01,A15,81,01,A20, Man, that'll be a rush man4tatlbearas RA25,81,01,A15,81,01,A30,81,01, Get in there quick, waste the mama cat, gatantarkwik4wasttematrdak R81,01,A25,81,01,A20, ...then pick the kittens off one by one. tanpaktedaklagsafwanbiwan RA25,81,01,A15,81,01,A20,81,02, That's the way to do it tatstewatuduat R81,01,A35,81,01,A20, c X t 2 3 F 4 5 u P C U F 01h U 7W K X A ,,QRwST K P F RuA vw P K Oj kl Mission Briefing.Gateway System, $T hours, $D. All right, folks, we'll be pulling out from Gateway tomorrow... alrit2foks4welbepalagowtframmacalaftumaro ...but before we do, we've got a few tankers and 'sports coming in. batbeforwedu4wevgatafutankrsadsportscomagin Since yesterday's attack on the Tiger's Claw... sinsyestrdasatakantetigrskla RA45,81,01,235,81,01,A50,81,02,135,81,01, ...it's clear we need to be especially vigilant in escorting these ships. itsclerwenedtubeaspasalevagalananaskortagtessips RA45,81,01,235,81,01,A50,81,02,135,81,01, Now, here are the assignments for transport escorts... now3herarteasinmatsfortransportaskorts RA45,81,01,135,81,01,A50,81,02,240,81,01, The colonel makes the assignments for the wings.You draw the final run... 5,8, $C and Paladin will take the last detail. jezwizadpaladanwaltaktelasdetal 5,9, $C, you'll be flying the last detail solo. jezwiz3yulbefliagtelasdetalsolo Here's the flight plan... hersteflitplan You'll meet a Drayman-class transport here, at Nav 1. As soon as it arrives, the 'sport will head for the Tiger's Claw. It'll be moving at top speed, and won't deviate from its shortest course... So you'll have to protect it from any attackers. soyulhavtuprotaktatframaneatakrs RA50,81,01,135,81,01,A30,81,02, Stay with her ... don't let enemy fighters draw you away from the tanker. satwather7donlatanamefitrsdrayuawaframtetankr RA50,81,01,135,81,01,A30,81,02, I've got one more bit of intelligence to pass along to everyone. ivgatwanmorbatafantalaganstupasalagtuavrewan We believe Bhurak Starkiller may be in the system. webelevburakstarkilrmabeantesastam Bhurak Starkiller, sir? burakstarkilr3sar RA50,81,01,A35,81,01,A30,81,02, He's Kilrah's hottest pilot in the Salthi light fighter. heskilrashataspilatantesaltelitfitr We don't know where he's likely to turn up... wedonnowerheslikletutarnap ...but one wing or another is bound to run into him. batwanwagoranatrasbownturanantuham So look alert out there, all right? Squadron dismissed. $ F 1 x K $ K P P 7 K SU wxP 4V K lm K 5 P UV P K EuA vK A ' U J P U P e Mission debriefing. $T hours, $D. 2,6,5,2, Well done, gentlemen. The 'sport's skipper asked me to thank you both. waldan3jantlman5tetankrcamandraskdmetucamandyubot 5,3, Good work out there, $C. The tanker skipper asked me to thank you. gudwrkowttar2dipstik5tetankrskipraskdmetutankyu R81,01,A35,81,02,A45, 3,4, And my personal congratulations for dispatching Bhurak Starkiller. admiprsanalcangrajulatansfordaspajagkajatefag R81,01,A35,81,02,A45, I'm just glad to get that fuel back to the Claw, sir. imjasgladtugattatfulbaktutecla3sar R81,01,A35,81,02,A45, 5,12, Now, don't go discountin' the fun in givin' the hairballs a black eye, lad. now3dontgodascowntntefanangavnteharbalsablaki3lad A45,R81,02,135,81,03,150, 2,12, So we lost the 'sport, $C? That's going to cost all of us, you know. sowelastetankr2dipstik4tatsgoagtocastalafas3yuno A45,81,03,A35,R81,05,A35,81,04,A40, I know, sir. But there were just too many enemy fighters... ino2sar4battarwarjastumaneanamefitrs RA45,81,01,A35,81,01,A50,81,02, 5,9, Paladin and I couldn't handle all of them at once... paladanadicudnthandlalaftematwans RA45,81,01,A35,81,02, I understand, son, but we were too short-handed to send two wings. iandrstan2san3batwewartusorthadedtusantuwags RA45,81,01,A35,81,01,A50,81,02, If we're going to win this war... afwergoagtuwantaswar RA45,81,01,A35,81,01,A50,81,02, ...we're all going to have to do the work of three men. weralgoagtuhavtudutewarkaftreman RA15,81,01,A15,81,01,A10,81,02, Enough of that, though. Let's review the mission... enafaftat2to5latsrevutemasn RA45,81,01,A35,81,01,450,81,02, 14, You racked up $K, $C... yurakdaptrekals2dipstik 15, No kills for you, $C... nokalsforyu2dipstik 5,18,16, and Paladin got $L of the hairballs. adpaladangatfivafteharbals 17, and Paladin came up empty. adpaladancamapamte 5,18, We lost Paladin out there. welaspaladanowttar A45,81,01,A35,81,01,R435,81,02, 3,20, And you shot down Bhurak Starkiller... adyushatdownkajatefag RA45,81,01,A35,81,01,A50,81,02, Everything else aside, $C, that was excellent work. avaretagalsasid2dipstik3tatwasaksalenwark RA45,81,01,A35,81,01,A50,81,02, 21, And I want to see you in my office later, $C. adiwantuseyuanmiafaclatr2dipstik Dismissed. dasmasd A $ ? 2 c i A FLA A ?mK F '-F A $QsA $Qs Hey there, $C. Get you something? yumatjokradbasmanovrtaryat 245,R81,02,A45,81,01,A35,81,01,A50, 5,3, I'm glad to see you and Paladin gettin' along so well. jokrsarellunatac9agudpilat4batwatuaratac RA45,81,01,A35,81,01,A50,81,02, He'll be retirin' soon, you know? hewasjascamagapastaputmeo RA45,81,01,A35,81,01,A50,81,02, 5,5, I'm glad to see you and Paladin were gettin' along so well. jokrsarellunatac9agudpilat4batwatuaratac RA45,81,01,A35,81,01,A50,81,02, He was s'posed to retire soon, you know? hewasjascamagapastaputmeowttopastur RA45,81,01,A35,81,01,A50,81,02, Been flyin' fighters for twenty-odd years... jasbetwenyuadme4idrathrflialontanwat A45,81,01,A35,R81,01,240,81,01,A50, 5,7, ...and now they're puttin' him out to pasture. adnowtharpatnhimowttupasjur 235,R81,01,A35,81,01,A50,81,02, 5,8, ...and he buys it a month before his retirement. adhebisatamantbeforhasretirman 235,R81,01,A35,81,01,A50,81,02, He and I used to fly together back before the war started. hesareltemledrnathrstore3thonathrstore3tho RA45,81,01,A35,81,01,A50,81,02, Darn good man ... the old Claw'll miss him. akrakpilat4watsavntenyersbehidham A45,R81,01,435,81,01,440, A 2 X F x y F F ABz K P JU jpK ?A A $C, sit down. I want to compare notes with you. dipstik2satdown3iwantucamparnotswatyu RA45,81,01,A35,81,01,A50,81,02, I've been watching the way Dralthi maneuver... ivbenwajagtewadraltemanuvr RA45,81,01,A35,81,01,A50,81,02, ...and I think I've noticed something. aditankivnotisdsamtag RA45,81,01,A35,81,01,A50,81,02, Seems to me that when you're hot on a Dralthi's tail... semstumetatwanyurhatanadraltistal RA45,81,01,A35,81,01,A50,81,02, ...and he pulls a loop to shake you... adhepalsaluptusakyu RA45,81,01,A35,81,01,A50,81,02, ...he always goes up or down, never to the side. Ever notice that? healwasgosapordown3navrtutesid7evrnotastat RA45,81,01,A35,81,01,A50,81,02, You shrug in tentative agreement. RA45,81,01,A35,81,01,A50,81,02, Well, they do ... always up or down, never left or right. wal3tadu6alwasapordown4nevrlaforrit RA45,81,01,A35,81,01,A50,81,02, 5,9, Y'know, lad, I believe you're right. yano2lad3itankyurrit RA45,81,01,A35,81,01,A50,81,02, I think it's because those big wings block their vision to the sides... itankatsbecaztosbagwagsblaktarvazantutesids RA45,81,01,A35,81,01,A50,81,02, but above and below ... between the wings ... their vision is clear. batabavadbelo3betwentewags5tarvazanascler RA45,81,01,A35,81,01,A50,81,02, a A K klA EF efA 92 YZF K 0xK 0x I'd like ta tell you, laddie, s'been good flyin' with you. idliktatalya2lade4sbangudfliagwatya RA45,81,01,A35,81,01,A50,81,02, We'll be pullin' outa Gateway soon... welbepalanowtagatwasun 235,R81,01,A35,81,01,A50,81,02, ...an' the colonel likes to shake up the wings every now an' then. antekarnallikstusakaptewagsavrenowanten RA45,81,01,A35,81,01,A50,81,02, So let me give you one last piece of advice... solatmegavyuwanlaspesafadvis RA45,81,01,A35,81,01,A50,81,02, ...a young wingman ain't goin' ta stick by you the way I have, lad. ayugwagmanantgoantastakbiyatewaihav2lad RA45,81,01,A35,81,01,A50,81,02, That's no criticism of 'em, lad, just a fact. tatsnocratasasmafam2lad3jasafakt RA45,81,01,A35,81,01,A50,81,02, A youngster's got a name to make and a career to think on... ayagstersgatanamtumakadacarertutankan RA45,81,01,A35,81,01,A50,81,02, ...'e'll be lookin' to make a hero of 'imself. helbelukantumakaheroafhamsef RA45,81,01,A35,81,01,A50,81,02, An old man like meself, on the other hand... anoldmanlakmisefanteatrhan RA45,81,01,A35,81,01,A50,81,02, ...well, I'm just wantin' to make it back so I can retire in one piece. wel4imjaswantntumakatbaksoicanretiranwanpes 445,81,02,430,R81,02,A45,81,01,A35, , X 0 1 2 3 Y Z L 8 2 tu G 2 H 2 Qn gh2 ,01,23qr 2 st K 2 D,deyz,deyz Mission Briefing.Gimle System, $T hours, $D. All right, boys and girls, listen up. We've just jumped into the Gimle System,and we've got some work to do. wevjasjampdantutegamlesastamp3adwevgatsamwarktudu RA30,81,01,140,81,01,240,81,01,A40,81,01, Gimle has been occupiedby the Kilrathi for some time. gamlehasbanakupidbitekalrateforsamtim RA40,81,01,A30,81,01, The Claw is not the first Terran ship to arrive... teclaasnattefarstaransaptyariv A10,81,02,R140,81,01,135,81,01, ...we've got a handful of battleships already in system. wevgatahanfalafbatlsapsalradeansastam RA40,81,01,A30,81,01, Most of these ships are currently under attack by Kilrathi... mosaftessapsarcaranleandratakbikalrate A10,81,02,R240,81,01,235,81,01, ...so we'll be dispatching fighters to help in their defense. sowelbedaspajagfitrstuhelpintardefans RA40,81,01,A30,81,01, The colonel quickly assigns the wings.Yours is the sixth assigned. blablablarubarblablegrivifo. A10,81,02,R240,81,01,235,81,01, $C, you'll lead Zeta Wing to assist an Exeter-class Destroyer. dipstik3yulledzatawagtuasastanaksatrclasdestruar RA40,81,01,A30,81,01, Angel will fly on your wing. RA40,81,01,A30,81,01, Here's the scenario... herstesanareo The Exeter is currently at Nav 1... ...her skipper reports at least three Kilrathi fighters in the area. You'll head straight for the Exeter, and help in her defense. When the Kilrathi have routed, come on back home. wantekalratehavrowtd3camanbakhom RA40,81,01,A30,81,01, Any questions? anekwastans Okay, then. Let's go burn those hairballs oka2tanp4latsgobarntosharbals R235,81,01,130,81,01,A40,81,01, Squadron dismissed. $ , c ; Be L $ G F P F P 67y2 F 2 16Vq 2 rw 2 2 2 , 2 e 2 2 Mission debriefing. $T hours, $D. 1,7, I just got word from the skipper of the destroyer, $C. ijasgatwrdframteskapraftedestrur3dipstik Well done. Those Jalthi are the best the Kilrathi have. waldanp4tosejaltiartebestekalratehav RA25,81,01,A35,81,01,A30,81,02, They were pretty tough, sir. But we got the job done. tawarpratetaf2sar4batwegattejabdan RA25,81,01,A35,81,01,A30,81,02, 4,11, Actually, mon colonel... aktuale3mancalanal RA25,81,01,A35,81,01,A30,81,02, ...the Confederate Raptor has only a 34 percent chance against the Jalthi. acanfadaratraptarhasonleatarteforparcanjansagansajalte RA25,81,01,A35,81,01,A30,81,02, All the more reason to be proud of yourselves, Captain Devereaux. altemorresantubeprowdafyorsevs2kaptandavaro R125,81,01,135,81,01,130,81,02, 1,11, We picked up the destruction of the Exeter on our sensors, $C. wepakdaptedestraktanafteaksatranarsansors3dipstik RA25,81,01,A35,81,01,A30,81,02, That ship was crucial to Confederation strategy in this sector... tatsapwaskrusaltucanfadaratanstratageantassactor RA25,81,01,A35,81,01,A30,81,02, Losing her is going to cost us dearly. lusagharasgoagtucasasderle RA25,81,01,A35,81,01,A30,81,02, I know, sir. ino3sar 430,81,05,RA25,81,01,A35,81,01, Well, let's review the mission report. walp3latsrevutemisnreport RA25,81,01,A35,81,01,A30,81,02, 13, You took out $K Kilrathi, $C... yutukowttrekalrate3dipstik 14, That's no kills for you, $C... tatsnokalsforyup3dipstik 15, while Angel got $L. wilanjlgatsavn 16, and Angel came up empty. adanjlcamapamte 4,17, The Kilrathi took Angel out. tekalratetukanjlowt RA25,81,01,A35,81,01,A30,81,02, 18, Be in my office in an hour, $C. beanmiafasananowr3dipstik RA25,81,01,A35,81,01,A30,81,02, That's all, then. tatsalten 2 1 V 2 v w 2 -K MNK YK yz2 Lx2 Lx Hey, there, $C. Welcome to the Gimle System... hatar2dipstikp5walkamtutegamlesastam R81,02,A35,81,01,A25,81,01,A30, ...vacation spot of the Empire of Kilrah vakatanspatafteampirafkalra R81,02,A35,81,01,A25,81,01,A30, Gimle's habitable world is one huge forest... gamleshabatablworldaswanhujforas R81,02,A35,81,01,A25,81,01,A30, Kilrathi nobles and officers come here to hunt with their bare claws. kalratenoblsadafasrscamhertuhantwattarbarclas R81,02,A35,81,01,A25,81,01,A30, I hear they bring human POWs here and turn them loose in the woods... ihertabreghumanpeodablusheradtarntamlusantewods R81,02,A35,81,01,A25,81,01,A30, ...just so those hairy brutes can get their kicks by huntin'em down jassotosharebrutscangattarkaksbihantnemdown A40,R81,01,635,81,01,630,81,02, Man, I'll be glad when we kick those fleabags outta the sector manp3ilbegladwanwekiktosflebagsowtatesaktor R645,81,01,635,81,01,650,81,02, 2 2 B C 2 2 9x2 2 2 Ah, bonjour, $R a3bansur2kaptan RA45,81,01,A35,81,01,A50,81,02, I have been reviewing our data on the Kilrathi starfighters. ihavbanravuagardataantekalratestarfitrs RA45,81,01,A35,81,01,A50,81,02, Our information indicates that in all cases... aranformatanandakatstatanalcasas 425,81,01,RA45,81,01,A35,81,01, ...their side armor is weaker than that to the front or rear. tarsidarmraswekrtantatutefranarrer RA45,81,01,A35,81,01,A50,81,02, One more reason not to play chicken with a Jalthi. wanmorresannattuplajaknwatajalte3dipstik 245,81,01,235,R81,01,A50,81,02,A35, Indeed, monsieur. The best attack line would be from the flanks. anded2msu2p4tebasataklinwadbeframteflaks 140,81,01,RA45,81,01,A35,81,01, 3 2 S T q 2 7 CZF zF z Let me give you a tip, kid... latmegavyuatap3kad RA45,81,01,A35,81,01,A50,81,02, Never rush a Jalthi head on. navrrasajaltehadan RA45,81,01,A35,81,01,A50,81,02, A Jalthi carries six front-mounted laser cannons... ajaltecaressiksfranmowntdlasarcanan RA45,81,01,A35,81,01,A50,81,02, First shot takes out your shields... farssattaksowtyurselds RA45,81,01,A35,81,01,A50,81,02, ...next'll blow through the cockpit into the reactor. nakslblotruyurkakpatantutereactr RA45,81,01,A35,81,01,A50,81,02, z 8 I G g 0 1 d 2 3 W X M Y Z P F A7 2 Z Z- tu, ,Sw P J P ip P Js Ic2 Z ; X M RtK Z Z 67v Mission Briefing.Gimle System, $T hours, $D. Twenty minutes into the briefing... ...and the last patrol will be Omicron wing. andelastpatrwlwilbeamicronwin RA30,81,01,225,81,01,A45,81,02, 4,4, That'll be $C and Angel. datlbedipsticandanjal A20,81,01,125,R81,01,A45, 4,5, You'll be flying solo on this one, $C. ulbeflingsolondiswon2grifn R145,81,01,A35,81,01,A50,81,02, Right, sir. rit2sur RA45,81,01,A35,81,01,A50,81,02, It's a simple, three-point patrol route. itsasimpul2treepointpatoloot RA45,81,01,A35,81,01,A50,81,02, Let's take a look at your flight plan. letstakalookatyurflitplan 135,81,01,140,R81,01,A45, Computer, display Omicron. camputr3dasplaomicron Just fly by each Nav Point, watching for signs of enemy activity. jasflitbiecnavpunt3watcinfurenamiactiviti There's a field of what looks like asteroids around Nav 1... dersafeeldufwutlokslikasteroidsarundnavwun ...so watch yourself in that area. prabablejasastruds4batatcudbeakalrateminfeld Now, there's just one more thing about this mission I need to mention... now2dersjustwunmordingabutdismisoninedtomentun A5,81,01,R135,81,01,A30,81,02, 4,14, We've just gotten a pair of prototype starfighters, Rapier-class. wevjustgotenaparufprototipstarfitersm2rapirclas RA45,81,01,135,81,01,A50,81,02, 4,15, We've just received a prototype of the new Rapier-class fighter. wevjustrecevddprotipufdanurapirclasfitur A45,81,01,A35,81,01,R250,81,02, The brass wants to know how the Rapier performs in action... dabraswantonohaowdarapirpurformsinacton RA30,81,01,A40,81,02,A35,81,01, ...so I want you to put her through the paces. soiwantutoputertrudepasis R130,81,01,A40,81,01,A35,81,01, Good job, $C, you lucky bloke Let me know 'ow she feels gudob2dipstic2yulakeblok$5letmenoawsefels 230,81,01,235,81,01,RA40,81,01, Now, I don't want you going nuts out there, $C... nowidonwantewgoinutsawtder2dipstic RA30,81,01,A45,81,02,130,81,01, This is a hot piece of hardware, but it hasn't been tested under fire. disisahotpisofhardwar2butithasnbintestidundrfir RA25,81,01,A40,81,01,A35,81,01, No one really knows what she can do ... or what she can't. nunrilinoswutsecando2aorwutsecant RA25,81,01,A40,81,01,A35,81,01, I understand, sir. Don't try anything too fancy... iundurstan2sur3mdontrinidintofansi RA40,81,02,A35,81,01,A40,81,01, Good. gud 125,81,01,RA40,81,01,A30,81,01, Now, if there aren't any questions... naw2ifderarntinicwestuns R235,81,01,130,81,01,A45,81,02, All right, then. Squadron dismissed. $ 2 ' Y 2 2 $G2 kv2 Y 2 2 N2 2 c 2 2 $ 2 c2 2 2 6Sj2 kp 2 2 Bn2 2 Mission debriefing. $T hours, $D. Welcome back, $C. What'd you think of the Rapier? welcumbak2dipstic2m2wududincufdarapir RA25,81,01,A35,81,01,A40,81,02, She's quite a ship, sir. sescwitasip2sur RA45,81,01,A35,81,01,A50,81,02, 1,4, She slid through the asteroids at Nav 1 well enough. seslidtrudeastroidsatnavwunwelinuf A45,81,01,A35,R81,02,250,81,01,235, 3,5,4,5, And she handled real well against a wing of Gratha near Nav 3. ansehanduldrilwelaginstacupulufgradanirnavtree 125,81,02,130,R81,02,A45,81,01,A35, 3,6,4,6, She didn't feel too good against a wing of Gratha near Nav 3, though. sedidntfiltugudaginstacupulufgratanirnavtre2tow A45,81,05,R435,81,03,450,81,02, 4,10, And what did you think, Devereaux? andwatidyewdink2devero RA45,81,03,A35,81,01,A35,81,01, 30,8, I must agree with the $R, mon colonel. It is quite a vessel. imustagrewitaboso2moncolonelnm2itiscwitavesal RA45,81,01,A35,81,01,A50,81,02, I believe that it will prove more effective even than the Raptor... ibileevtatitwilpruvmorefectifevntanteraptor RA45,81,01,A35,81,01, 2,10, ...especially against the more nimble Kilrathi fighters. espesulyaginstemornimbulkilratifiturs RA45,81,01,A35,81,01,A50,81,02, Very well, then. I'll pass that along to Tactical. veriwel3den5aylpasdatalontotactical RA20,81,01,A25,81,01,A40,81,02, I've already reviewed your flight recorder's mission report. ifulredirvuwdyurcompewtursmisonreport RA45,81,01,A35,81,01,450,81,02, 14, You skragged $K Kilrathi, $C... yuskragdsevnkalratefitrs3dipstik 15, I saw no kills for you, $C... isanokalsforyu2dipstik 4,18,16, and Angel did in $L herself. adanguldadansevnhamsef 17, and Angel came up empty. adanjilcamapamte 4,18, And the fleabags took out Angel. adteflebagstokatangul RA45,81,01,A35,81,01,A50,81,02, 19, Oh, and $C, I want to see you in my office after you've cleaned up. o2adjezwiz4iwantuseyuanmiafazaftryuvclendap RA45,81,01,A35,81,01,A50,81,02, Dismissed. dasmasd 2 2 2 V W 2 2 A2 22 RS2 RS Hey, $C. How's it goin'? ha2dipstikp4howsatgoan 245,R81,02,A45,81,01,A35,81,01,A50, You heard about those new Rapiers? Ever'body's talkin' about 'em. yuhardabowttosnurapearsp3avrbodestakanabowtam RA45,81,01,A35,81,01,A50,81,02, I'm not so sure about 'em, though. imnatsosurabowtam2to RA45,81,01,A35,81,01,A50,81,02, I flew jus' about my whole career in Scimitars an' Raptors. iflujasabowtmiholkareransamatarsanraptors A45,81,01,A35,R81,01,240,81,01,A50, Liked the Raptor best, even though she didn't handle too good. likdteraptorbesp3evntosedadnhandltugud 235,R81,01,A35,81,01,A50,81,02, She sure was fast once you got her goin', though sesurwasfaswansyugathergroin3to RA45,81,01,A35,81,01,A50,81,02, 2 ? 2 2 2 ;2 '2 KL2 KL $C, mate Have you 'eard the news? dipstik2mait5hafuardinews RA45,81,01,A35,81,01,A50,81,02, The Claw's gettin' a prototype Rapier to test fly daclawsgetinaprototiprapirtotestfli RA45,81,01,A35,81,01,A50,81,02, I've been lookin' over the specs on 'er. ibinlokinofirtespecsonir RA45,81,01,A35,81,01,A50,81,02, She's tagged a light fighter, but she's better armed than a Scimitar. sestagdalitfitr2butsesgotmorgunsanasimitar RA45,81,01,A35,81,01,A50,81,02, There's a pair of laser cannons, for distance work... dersaparoflasircanon3fordistinswirc 245,81,01,235,R81,01,A50,81,02,A35, ...an' a set of neutron guns, for the dirty infightin' anasetofnutronguns2fortedirtinfitin 140,81,01,RA45,81,01,A35,81,01, 2 a 2 2 ,D2 de2 $2 DE2 2 I'm lookin' forward to seein' one of these new Rapiers imlokinforwartosinwonoftesenurapirs$4m RA45,81,01,A35,81,01,A50,81,02, They say she's got tougher shields than anything in the fleet. deysasesgotufrsildstaninitinintaflet RA45,81,01,A35,81,01,A50,81,02, She must be just about invulnerable semusbejusabotinfulnrbl RA45,81,01,A35,81,01,A50,81,02, 'Ang about, there, mate... anabot2ter3mait R245,81,01,235,81,01,250,81,02, She may 'ave God's own shields, but she's armored like a light fighter. semaiavgodsonsields3butsesarmrdlikalitfitr R245,81,01,235,81,01,250,81,02, If they knock down the shields, she's no tougher than a Hornet. ifteynocdontesilds3sesnotufrtanahornet RA45,81,01,235,81,01,A50,81,02, Wow, I never thought about that... woaw4inefrtotabotat R145,81,01,135,81,01,A50,81,02, i v 0 1 2 2 3 P a 2 2 A 2 ab 2 2 45 2 ' 2 AGs2 ,,12w34de P fg Z T F tu F 5P KRP $P P pq P 32 STf 2 P ?F Mission Briefing.Gimle System, $T hours, $D. All right, boys and girls... alrit2boysangrls R230,81,01,135,81,01,A50,81,02, ...we got several groups of bogies on the move. wegotsefralgrupsofbogesontemuv RA30,81,01,A40,81,01,A35,81,01, Either the Kilrathi are pulling out of Gimle... edertekilratiarpulngaotofgimli RA35,81,01,240,81,01,A40,81,01, ...or they're gearing up to push us out. ortergeringuptopususat RA45,81,01,135,81,01,A50,81,02, Either way, we got to find out what they're up to. ederwai3wegotofindatwuterupto RA45,81,01,A35,81,01,A50,81,02, First up on the hit parade is what looks like a squadron of fighters. furstupontehitparaidiswutlokslikascwadrunoffitrs RA45,81,01,A35,81,01,A50,81,02, 4,8, $C and Angel will fly Tau Wing to check it out. dipsticandanglwilflitawingtocecitaut 135,81,01,140,R81,01,A45, 4,9, $C, you're flying Tau Wing to check it out. dipstic2yurflintawingtocecitawt 135,81,01,140,R81,01,A45, Computer, display Tau. camputr3dasplaitaw Nav 1 indicates their last confirmed position. We believe the bogies are Dralthi... ...and we estimate their present location here. If you think you can take them, go ahead and engage... ifutincucantaictem2goahedandingaj RA45,81,01,135,81,01,A50,81,02, ...but break off if the squadron turns out to be too big to handle. butbraicofiftescwadrunturnsawtobetobigtohandul 145,81,01,RA35,81,01,A50,81,02, Remember, $C, I need information worse than I need heroes. remembr2dipstic2inedinformasunwurstaninedheros RA5,81,01,135,81,01,A30,81,02, Any questions, then, Tau Wing? anicwestons2ten2tawing R135,81,01,145,81,02, 4,18, I have heard that the Kilrathi ace Dakhath is in this sector... ihafhurdtattekilratiaisdachatisintissector R135,81,01,A30,81,01,140,81,01, 4,19, I've heard Dakhath, the Dralthi ace, is in Gimle. Is that true? ihafhurddakhat2tedraltiais2isingmli5istatru R135,81,01,A30,81,01,140,81,01, We believe he may be, so be careful. webelifhemabe2sobecarful R135,81,01,A30,81,01,140,81,01, Dakhath is very dangerous ... we need to know if he's here. dachatisveridangirus3wenedtonoifhesher 120,81,01,RA50,81,02,A40,81,01, Yes, sir. yes2sur R135,81,01,A30,81,01,A40,81,01, Right, then. Let's move along. rit2ten4letsmovalong RA30,81,01,A45,81,01,A35,81,01, The colonel runs through the rest of the assignments... blablablarubarbspamspamspamhumbuglalavreen RA30,81,01,225,81,01,140,81,01, ...dispatching four more wings to check out other bogies. wuntwotweefowfif3blortblabrompploom 140,81,01,130,81,01,RA40,81,01, All right, then. Squadron dismissed. alrit2ten2m2scwadrundismisd $ 2 ' B X 2 Y 2 2 STjy2 2 B2 bi 2 2 ?Gv2 2 56k 2 2 ,-2 2 2 2 ;Td 2 el 2 2 34F 2 fg 2 fg Mission debriefing. $T hours, $D. How'd it go out there, $C? howditgoawter2dipstic 30,9, Well enough, sir. They were Dralthi ... two wings, nine in all. welenuf2sur4teywerdralti3twoings2naninal RA45,81,01,A35,81,01,A50,81,02, 6,12, Dakhath was leading the second wing. dakatwasledintesecondwing A45,81,01,A35,R81,02,250,81,01,235, Did you take him out? didutaichimawt 125,81,02,RA40,81,02,A45,81,01, 7,7, I believe so, sir. His ship blew up, at least. ibelifso2sur4hissipblewup2atleest RA45,81,01,A30,81,01,A50,81,02, Excellent. Good work, $R. ecselent5gudwurk3radud A15,81,01,RA45,81,01,A35,81,01, 7,13, No, sir. He got away. no2sur4hegotawai A45,81,03,A35,R81,05,435,81,04,440, Oh, well. At least we've confirmed his presence in the system. owel4atlestwefconfirmdhispresinsintesistum RA45,81,01,A35,81,01,A50,81,02, 30,13, They were Dralthi, sir. At least five of them. teywurdralti2sur4atlestfifuftem RA45,81,01,A35,81,01, It didn't look good, so I decided to break off and report in. itdintlokgud3soidesidedtobrakofanreportin RA45,81,01,A35,81,01,A50,81,02, Probably the best decision, under the circumstances. probablitebestdesison2unurtesircumstansis RA25,81,01,A35,81,01,A40,81,02, 10,13, I'll dispatch a strike wing to clean them up. awldistpatcastrikwintocleentemup RA25,81,01,A35,81,01,A40,81,02, I've got your numbers from the mission report. aifgoturnumbursfrumtemisonreport RA45,81,01,A35,81,01,450,81,02, 15, You killed $K Kilrathi, $C... yufractupsefnkils2dipstic 16, Nothing for you, $C... notinforyew4dipstic 4,19,17, and Angel got $L. andainjulgotsefn 18, and none for Angel. andnunforainjul 4,19, And Angel didn't make it back. andainjuldidntmaikitbac RA35,81,01,445,81,03,A45,81,01, 21, I want to see you in my office later, $C. iwantoseyewinmiofislatur3dipstic RA45,81,01,A35,81,01,A50,81,02, Yes, sir. yes2sur RA45,81,01,A35,81,01,A50,81,02, All right, then. Dismissed. alrit2tan4dasmasd 2 7 Y 2 2 R2 2 ;q2 2 V2 V You hear what they're sayin' in Blue Devil Squadron? yewherwutersaininbludefulscwadrun 245,R81,02,A45,81,01,A35,81,01,A50, Word is, one of their boys ran into Dakhath on patrol yesterday. wurdis3wunufterboisranintodachatonpatrolyestirdai RA45,81,01,A35,81,01,A50,81,02, You know Dakhath, right? The Kilrathi ace that flies a Dralthi? yewnodachat2rit4tekilrataistatflisadralti RA45,81,01,A35,81,01,A50,81,02, He's got 78 confirmed kills, counting fighters and capital ships. hesgotsefuntiaitconfirmdcils3cawntinfitursancapitulsips A45,81,01,A35,R81,01,240,81,01,A50, They say his name means 'Deathstroke' in Kilrathi... teysaihisnaimmeensdetstroc2incilrati 235,R81,01,A35,81,01,A50,81,02, ...'cause how he gets his jollies. cawshowhegetshisjawlis RA45,81,01,A35,81,01,A50,81,02, He likes to shoot pilots who've ejected as they wait for a pick up. helikstosootpilotshofejectidasteywaitforapicup RA45,81,01,A35,81,01,A50,81,02, 2 2 V d v w 2 2 KL2 2 So, $C. Now you've flown a Rapier. You like it? so2dipstic3nawuflownarapir5yewlicit RA45,81,01,A35,81,01,A50,81,02, You nod as you sip your drink. RA45,81,01,A35,81,01,A50,81,02, I read that we're getting the first Rapier squadron on active duty. iredtatwirgetintefurstrapirscwadrunonactifduti RA45,81,01,A35,81,01,A50,81,02, Colonel's already named the squadron Black Lion... curnulsalredinamdtescwadrunblaclion RA45,81,01,A35,81,01,A50,81,02, I wonder who'll be assigned to it? iwundrwowilbeasindtoit 245,81,01,235,R81,01,A50,81,02,A35, 2 3 V 2 v w 2 O2 op2 2 2 'Xz2 'Xz Lot of talk going around about this Dakhath guy. lotuftawkgoinarawndabottisdachatgi R145,81,01,A40,81,01,A50,81,02, Well, don't sweat that fuzzball too much. wel2dontswettatfusbawltumuc RA45,81,01,A35,81,01,A50,81,02, Casey ran into Dakhath a couple of years ago, near Planck's Star. casiranintodachatacupulufyirsago3nirplancsstar 120,81,01,RA45,81,01,A35,81,01, Dakhath got his rep by shooting helpless men... $3dachatgothisrepbisootanhelplisman 210,81,01,RA45,81,01,A40,81,01, ...but he's not so tough if you're still in your ship. buthesnotsotufifyurstilinyursip RA45,81,01,A35,81,01,A50,81,02, Watch him when you're on his tail. watshimwinyuronhistail RA45,81,01,A35,81,01,A50,81,02, He likes to burn out with his afterburners... helikstoburnawtwithisafturburnrs RA45,81,01,A35,81,01,A50,81,02, or he'll try to get behind you with a kickstop. orhiltritogetbehindyewwitacicstop RA45,81,01,A35,81,01,A50,81,02, v m 4 5 d 6 7 v U U UV 5 K qr7 K EF A A vw- A ; 7 F aci - - ? 7 7 7 E 7 uv - K CDx Mission Briefing.Brimstone System, $T hours, $D. Good morning, boys and girls. Welcome to the Brimstone System. gudmornag2boisadgrlsp5walkamtutebramstonsastam As you know, there are several Kilrathi military bases on the second planet. asyunop3tararsavralkalratemalatarebasasantesacadplanat RA40,81,01,245,81,01,A50,81,02,135,81,01, We are here to scout the system before a possible Confederation invasion. wearhertuscowttesastambeforapasablconfadarataninvasan RA40,81,01,245,81,01,A50,81,02,135,81,01, Way to go, Chief Finally, we get some real action $3watugojef5finalewegatsamrelaktan$99 RA20,81,01,A15,81,02, That will mean a heavy patrol schedule... tatwalmenahavepatrolskedul RA40,81,01,245,81,01,A50,81,02,135,81,01, Patrol schedule? Aw, hell, that's no fun patrolskedulp7awhalp4tatsnofan A10,R81,01,625,81,02,620, ...as we gather intelligence on the strength of local Kilrathi forces. aswegatrantalajansantestragtavloclkalrateforsas RA40,81,01,245,81,01,A50,81,02,135,81,01, You're first in the rotation, $C. For your wing, I want you to take... yurfrsanterotatan2dipstikp5foryurwag3iwanyututak RA40,81,01,A35,81,01, ...Maniac, I think. He seems to be anxious for an assignment. p5maneak3itankp4hesemstubeankseasforanasinmat A15,120,81,01,A20,R81,01,245, Oh, sure. Send me. osurp8sanme A20,R81,01,415,81,01,420, I wouldn't want you to trouble Iceman or Hunter with a routine patrol. iwadntwanyututrablismanorhantrwatarutenpatrol 425,RA40,81,01,A30,81,02, Stow it, Marshall. There's always lavatories to scrub, if you'd rather. stoat2marsalp5tarsalwaslavatorestuscrub2afyudratr 620,R81,01,240,81,01,245, m5o99 R540,81,01,530,81,02, I thought so. itatso R81,01,240,81,01,245, Now, let's look at your patrol plan, $C. nowp2latslukatyurpatrolplan2dipstik It's a simple three-point route, with a few asteroids near Nav 2. Keep alert. We really don't know what to expect out there... ...but we know we're in hairball territory. batwenoweranharbaltaratore Just fly your route and get back with a report... jasfliyurrutadgatbakwatareport ...and if Maniac gives you any static... adafmaneakgavsyuanestatak RA40,81,01,A45,81,01, ...you have my permission to shoot him to pieces. yuhavmiparmasantushuthamtopesas A40,R81,01,245,81,01,240, Should I use missiles, sir, or ship's guns? sudiusmaslssarp2orsapsgans$20 RA40,81,01,A50,81,02, Guns, $C. Save your missiles for important targets. gansdipstikp5savyurmislsforamportattargats$20 RA40,81,01,A50,81,02, What? wat 510,R81,01,520, Squadron dismissed. $ U C Y F Z F U jF P 0a P P Ll P P ;7 7 7 7 BYg7 ho2 2 2 Mission debriefing. $T hours, $D. $7, Nice work out there, $C. nisworkowttar3dipstik 6,5, You both handled a dangerous situation well. yubothandldadanjrassatuatanwal RA40,81,01,A30,81,02,135,81,01, Thanks, Chief. We were just too much for 'em. tanks2jef$4wewarjastumajforam$99 RA35,81,01,A40,81,01,A30,81,01, It got pretty rough, but we came through it. atgatprateraf2batwekamtruit RA35,81,01,A40,81,01,A30,81,01, 6,10, Thank you, sir. I only wish Maniac had made it back, too. tankyu2sarp3ionlewasmaneakhadmadatbaktu A35,81,01,A40,81,01,R430,81,03, He got careless, $C. Don't let it happen to you. hegatcarlas2dipstikp4donlatathapntuyu RA35,81,01,A40,81,01,A30,81,01, 10, So you ran into a few furballs out there, $C? soyuranantuafufarbalsowttar2dipstik RA35,81,01,A40,81,01,A30,81,01, Yes sir. Looked like they were expecting us. yassarp3lakdlaktawarakspektagas R435,81,01,A40,81,01,A30,81,01, Don't let them get the jump on you, son. You may not come back. donlattamgattejampanyu2sanp4yumanatkambak R635,81,01,640,81,01, Let's go over the report from your recorder. latsgoovrtereportframyurrecordr RA40,81,01,A30,81,02,135,81,01, 12, You toasted $K of their ships, $C... yutostedsevnkalratefitrs3dipstik 13, No kills for you, $C... nokalsforyu2dipstik 14, and Maniac got $L of the hairballs. admaneacgatfivafteharbals 15, and Maniac struck out. admanacstukot 6,16, Maniac bought it out there. maneakbatatowttar A45,81,01,A35,81,01,R435,81,02, 17, And I want to see you in my office later, $C. adiwantuseyuanmiafaclatr2dipstik Dismissed. dasmasd 7 7 7 Y2 yz2 yz Hey, $C. Get you something? hia2dipstikp5gityasumtin 245,R81,02,A45,81,01,A35,81,01,A50, Been awfully quiet 'round here since we jumped into Brimstone. banaflekwitrownhersanswejampdantubramston RA45,81,01,A35,81,01,A50,81,02, Scuttlebutt is that there are four Kilrathi bases on Brimstone II... skatlbatastattararforkalratebasasanbramstontu RA45,81,01,235,81,01,A50,81,02, ...an' we're lookin' at some serious action, real soon. anwerluknatsamsereasaktan3relsun RA45,81,01,235,81,01,A50,81,02, 8 2 X Y 7 6- VWq2 Z z D D G'day, $C ... pull up a chair. gda3dipstikp5palapajar RA45,81,01,A35,81,01,A50,81,02, Maniac an' I 'ave just been tradin' war stories... maneakaniavjasbantradanwarstores RA45,81,01,A35,81,01,A50,81,02, ...trying to come up with some clues on 'ow the Kilrathi think. triagtucamapwatsamclusanowtekalratetank RA45,81,01,A35,81,01,A50,81,02, That is, WHEN they think. datis2windeytink$10 215,81,01,225,R81,01,A20, Oh, they'll surprise you, sometimes, mate. oh2deylsuprizu2sumtims2mat R145,81,01,135,81,01,150,81,02, Their favorite trick is to set up a good ambush... derfavritricastosetupagudambush RA45,81,01,A35,81,01,A50,81,02, ...so if you see a lone furball with a broke wing, watch y'self. soafyusealonfarbalwatabrokwag3wajysef RA45,81,01,A35,81,01,A50,81,02, 'E's got mates right around the corner. esgatmatsritarowdtecornr RA45,81,01,A35,81,01,A50,81,02, x C D d x F fg fg Have a seat, $C. havaset2dipstik RA25,81,01,A20,81,01,A30,81,01, Hope we see some action soon... hopwelsesumaktonsun 225,R81,01,A35,81,01,A20, ...I'm looking forward to scoring some more kills. imlukagforwrdtoscoragsamorkals R81,01,A25,81,01,A20, By the way, I hear we'll be flying together. biteway2iherwelbefliagtogatr RA25,81,01,A25,81,01,A20,81,02, They say you're almost as good as me. tasayuralmosasgudasme R81,01,A35,81,01,A20, m m u 4 5 d 6 7 R S T U K K K uv F 'M wx K U Nk ,,01w23ef K gh U ? F UV F U NlK P 8k lm 2 Mission Briefing.Brimstone System, $T hours, $D. All right, boys and girls. We're gearing up for a major assault on the Kilrathi bases on Brimstone II. wirgirinupforamajorasaltontekalratebasasanbramstontu Headquarters has dispatched several more warships to this system... hedcortrshasdispacdsevrulmorworsipstotissistim RA45,81,01,235,81,01,A50,81,02,135,81,01, ...they'll be coming in over the next few hours. telbecomininofirtenectfewhars RA45,81,01,235,81,01,A50,81,02,135,81,01, Here are the assignments for rendezvous and escorts... herarteasinmintsforrendevooandascorts RA45,81,01,135,81,01,A50,81,02,240,81,01, The colonel makes the assignments for the wings.Yours is the last... 6,8, $C and Maniac will take the last run. jezwizadmaniacwaltaktelasrun R130,81,01,140,81,01, 6,9, $C, you'll fly the last run on your own. jezwiz3yulflitelasrunonyeron R130,81,01,140,81,01, Here's the flight plan... hersteflitplan You'll meet an Exeter-class destroyer at Nav 1, right here. You'll fly straight to Nav 1, to make the rendezvous on schedule... ...but you'll bring the destroyer back via Nav 2. This will keep the Exeter clear of the asteroids between here and Nav 1. tiswilkipteventurclirofteastoidsbetwenhirannavwun R130,81,01,140,81,01, Be sure and stay close to the destroyer. besuranstaiclostotedistroir R130,81,01,140,81,01, If you run into enemy fighters, they'll try to draw you off... ifyewrunintoenimifiturs3teltritodrawuof ...so their wingmen can get a clean shot at the Exeter. soterwinmancangitaclinsotattefentur 6,18, How close do you want us to stay, Colonel? hawclosdoyuwantustosta3cernal 110,81,01,R130,81,01,125,81,01, 6,19, How close do you want me to stay, Colonel? hoclostoyuwantustosta3cernal R130,81,01,140,81,01, Within 5,000 klicks, in a dogfight. Closer when you're just cruising. witinfiftawsanclics3inadogfit5closrwinyarjuscrusan Understood, sir. rit3sur5wilstictohur A9,R81,01,130,81,01,125, Good. gud That's it for today, then. Let's get to work. Squadron dismissed. $ Z 1 z P 2P HIP GZ ab Z P Lp P F kP F $W P 2 67J F F $n P 7 6;Zu7 v7 7 7 1QhK Mission debriefing. $T hours, $D. 2,7,6,2, Good job, men. The Exeter's pulled into formation with the Tiger's Claw. gudjob2min5teventurspuldintoformasunwitetigurscla 6,3, Good job, $C. The Exeter's pulled into formation with the Tiger's Claw. gudjob3dipstic5tevinturspuldintoformasonwittetigurscla R81,01,A35,81,02,A45, I'm glad to hear it, sir. We ran into a little trouble out there. imgladtuhirit3sur6weranintoalitultrublawter R81,01,A35,81,02,A45, 6,6, Yeah, the fleabags were all over that jump point like a cheap suit... yah3terwurcilratialofurtejumpointlikaceepsoot A15,R81,01,135,81,01,120, Nothing we couldn't handle, though. nutinwecudnthandul3tow RA20,81,01,135,81,03,130, You seem to have dealt with it adequately. yewseemtohafdeltwititadecwatli 110,R81,01,A35,81,02,A45, 2,16, I hope you enjoyed your little outing... ihopyuinjoidyurlitulawtin3gintulmin RA30,81,01,A35,81,01,A40,81,01, Would you like to explain why I'm looking at you, but not the Exeter? wudyuliktoecsplainwiimlokinatyu3butnotefentur R640,81,01,635,81,01,650,81,01, I'm sorry, sir ... There were Kilrathi everywhere at the rendezvous. imsori4sur6terwurcilratiefriwaratterawdevoo RA45,81,01,A35,81,01,A30,81,02, 6,11, Maniac and I couldn't keep up with all of them. manicandicudntkeepupwitaluftem RA45,81,01,A35,81,02, Losing that destroyer may cost us this system, $C. losintatdistroirmacostustissistim3dipstic A25,81,01,R645,81,01,635,81,01, We can't afford that kind of loss if we expect to hold this sector. wecantafordtatkinduflosifweecspectoholdissector RA45,81,01,A35,81,01,A50,81,02, I understand, sir. ay2undurstand5sur A30,81,01,435,81,02,RA25,81,01,A35,81,02, I had planned to move you over to a Raptor, with Star Slayer squadron... ihadplandtomuvyuofurtoaraptor3witstarslairscwadrun RA35,81,01,A45,81,02,A30,81,01, But now ... well, we'll just have to see how you do in the next few days. butnaw5wel2wiljusthaftosihawyudointenecstfewdais A10,81,01,420,R81,01,A35,81,01,A45, Enough of that, though. Let's review the mission... enufoftat3to5letsreviwtemison RA45,81,01,A35,81,01,A30,81,02, 18, You took out $K of them, $C... yutukawtsefunoftem4dipstic 19, No kills for you, $C... nokilsforyew3dipstic 6,22,20, and Maniac wasted $L of the hairballs. admanicwaistidtfivafteharbals 21, and Maniac came up empty. admanicamapamte 6,22, And Maniac didn't make it back. admaniacdiduntmakitbac A45,81,01,A35,81,01,R435,81,02, 23, And I want to see you in my office later, $C. adiwantosiyuinmiofislatur3dipstic Dismissed. dasmasd 7 $ b h 7 IJ7 7 CD7 ?z ?z Hey there, $C. Get you something? hayter2dipstic4getusomtin 245,R81,02,A45,81,01,A35,81,01,A50, 6,4, Don't feel too bad about Maniac, $C. dontfiltobadabotmanic4dipstic RA45,81,01,A35,81,01,A50,81,02, I been watchin' that kid since he hit the Tiger's Claw. ibinwatsintatkidsinsihittetigursclaw RA45,81,01,A40,81,01,A50,81,02, He was always reckless. Miracle he didn't get himself killed before. hewasalwaisreclis6miraculhediduntgithimsalfcildbefor RA45,81,01,435,81,01,A50,81,02, 6,8, How'd you like flyin' with Maniac? hawdyulakflinwitmanic RA35,81,01,A35,81,01,A50,81,02, I wouldn't trust the kid myself ... too damn reckless. iwadntrustekidmiself5todamreklis RA25,81,01,A30,81,02,A40,81,01, He's lookin' to be famous, an' its gonna get him killed. heslokintobefamus3anitsgointogithimkild 235,R81,01,A35,81,01,A40,81,02, I just hope he don't take anybody with him when he goes... ijushophedontaikanibodiwitimwinhegos 235,R81,01,A35,81,01,A40,81,02, E F JK ?7 V7 v Ah, $C. Sit down. a3dipstic5sitawn RA45,81,01,A35,81,01,A50,81,02, The colonel told me we'll fly escort for several incoming ships soon. tecurnaltoldmewilfiescortforsefrulincominsipssoon RA45,81,01,A35,81,01,A50,81,02, Since you are still new to the Tiger's Claw... sinsyuarstilnutotetigrsklaw RA40,81,01,A35,81,01,A50,81,02, ...let me give you a few pointers on escort missions. letmegifyuafupointursoneskortmisons RA35,81,01,A35,81,01,A50,81,02, First, it is better to strike a course parallel to the larger vessel... frst4itisbeturtostrikacorsparaleltotelarjurfesul RA40,81,02,A45,81,01,A40,81,01, ...than to try to circle it as it moves toward the destination. tantotritosirculitasitmofstordtedestinasun RA45,81,01,A35,81,01,A50,81,02, Maneuver a little behind and to one side of the larger ship... manovuralitulbehindantowunsidoftelarjursip RA45,81,01,A35,81,01,A50,81,02, 5,8, ...so you can see it as you fly alongside it. sowucanseitasyuflialonsidit 230,R81,01,145,81,01,135, Then set your speed to match its pace--usually 100 or 150 klicks. tensetyurspedtomatitspais4usaliwunhundredorwunfifticlics 110,R81,01,A45,81,01,A35,81,01,A40, 5,11, But speed back up to 200 or 250 if you meet Kilrathi, lad... butspedbakaptutoundridortofiftiifyumetcilrati3lad R145,81,01,135,81,01,A50,81,02, It's easy to forget to hit the juice when you first see the hairballs. itsisitoforgittohittejuswinyufurstseeteharbals RA45,81,01,A35,81,01,A50,81,02, J y 7 9 3U 3U Chen here 'as got some clever things to say about flying escort, lad... cenherasgotsumclefurtinstosaabotflinescort3lad A10,81,01,240,R81,01,A35,81,01,A50, ...but I've got a bit to add myself. butifgotabittoadmiself 135,R81,01,A35,81,01,A40,81,02, The most important thing is to keep your eye on your scanner. temostimportntinistokipyurionyurscanur RA30,81,01,A35,81,01,A40,81,01, Major Taggart is correct, $R. Pay special attention to your scanner. majortagurtiscorec4dipstic5paspesulatintontoyurscanur RA45,81,01,A35,81,01,A50,81,02, When you're flyin' up close to a big ship like a transport... winyurflinupclostoabigsiplikatransport RA45,81,01,A35,81,01,150,81,02, ...she can block out half the sky sicanblocawthafteski R145,81,02,A35,81,01,A30,81,01, Your scanner'll show enemies on the other side of 'er. yurscanurlsoenimisonteotursidofur RA35,81,01,A35,81,01,A40,81,02, , p P B 4 5 2 6 7 Z 5 Z 67 K K Z 4 Z d A 7 ' ,GHlm ,no , A ;d U K K -.BC -.BC Mission Briefing.Brimstone System, $T hours, $D. As you know, people, several warships have arrived in the last 48 hours. asuno3pepol3sevrulwarsipshafarivdintelastfortiaithors Most of these have headed in to beseige Kilrathi bases on Brimstone II. mostofteshafhedidintobeseejcilratibasisonbrimstontoo Under this blockade, the planet is desperate for munitions and supplies. undurtisblocad3teplanitisdespiritformunisunsandsuplis The Empire has dispatched dozens of Dorkir 'sports... teimpirhasdispacdosinsofdorkirsports RA45,81,01,135,81,01,A50,81,02,240,81,01, ...hoping at least a few of them will get past us and in to Brimstone II. hopinatlistafuoftemwilgitpastusadintobrimstontoo RA45,81,01,135,81,01,A50,81,02,240,81,01, Our mission is to make sure they don't get there. ormisonistomaksurteydontgiter RA45,81,01,235,81,01,A50,81,02,135,81,01, 6,8, $C, you and Maniac are first up. dipstic3yuanmanicarfurstup RA45,81,01,A35,81,01,A50,81,02, 6,9, $C, you're first up. dipstic4yerfurstup RA45,81,01,A35,81,01,A50,81,02, Computer, display Rho. A45,81,01,A35,81,01,R250,81,02, We've got a large bogie near Nav 1. Tactical is pretty sure this is one of those inbound Dorkir. We've detected at least four smaller bogies nearby... ...so watch out for fairly strong fighter escort. sowatawtforferlistronfiturescort R130,81,02,A50,81,01,A30,81,01, The colonel quickly assigns the rest of the wings... bitmeupandawn3donsanoitsblortibleen ...sending them to intercept other transports headed for Brimstone. gleengropupinigvlortrubarb Every tranpsort that gets past us drags the seige out another week... efritransportatgitspastusdragstesejatanutrwek R130,81,02,240,81,01,A35, ...so look sharp and don't let your target get past you. soluksarpandonleturtargitgitpastyu RA30,81,01,140,81,01,A20,81,01,235,81,01, Squadron dismissed. $ d 1 I P c q P P eP P V 2 2 6 Z VW Z . Z 7 d- - 3R- S- P Rwd d Mission debriefing. $T hours, $D. 1,7,6,2, Nicely done, gentlemen. nislidun3jintalmin 6,3, Good job, $R. gudjob3dipstic Tactical believes that 'sport was carrying ground-to-space missiles... taticalbelifstatsportwascaringrondtospaismisils RA30,81,02,A50,81,01,235,81,01, ...if they'd gotten to the planet, our losses would have been devastating. iftedgotintoteplanit3orlosiswudhafbindefistatin RA40,81,01,A20,81,02,A45,81,01, 6,13, I figured it was some sorta missiles, chief. ifigirditwassumsortamisils3ceef A5,R81,01,A20, You should have seen the explosion It was like a supernova usudhavsenteecsloson5itwuslikasupurnofa R81,01,A15,81,01,A20, 1,13, So she got by you, eh? sosigotbiu2a RA40,81,01,A35,81,01, I'm afraid so, sir. The fighter cover was just too tight. imafradso3sur7tefiturcoferwasjustotit RA30,81,02,A25,81,01,A40,81,01, Tactical thinks that ship was carrying ground-to-space missiles, $C. taticaltinstatsipwascareingrondtospaismisils3dipstic RA45,81,01,A35,81,01, We have no idea how many ships and men those missiles will cost us... wehafnoidehawmanisipsanmintosmisilswilcawstus RA35,81,01,A30,81,01,A40,81,01, ...but one ship or even one man is more than humanity can afford to lose. butonsiporefunwunmanismortanhumaniticanafordtolus RA35,81,01,A35,81,01,A30,81,01, 13, Well, let's go over the mission report from your flight recorder. wel3letsgofurtemisonreportfrumyurflitcomputer RA30,81,01,A35,81,01,440,81,01, 15, Recorder credits you with $K kills, $C... compewturcreditsuwitsufnkils4dipstic 16, Recorder shows no kills for you, $C... compewtursosnokilsforu3dipstic 6,19,17, ...and Maniac gets $L kills. admanicgetssufnkils 18, ...and none for Maniac. adnanformanic 6,19, And Maniac didn't make it back. admanicdidnmakatbak A45,81,01,A35,81,01,R435,81,02, 20, And $C ... I want to see you in my office in an hour. addipstik4iwanttuseyuanmiafisananowr RA45,81,01,A35,81,01,A50,81,02, That's all. Dismissed. tatsalten4dasmasd i - 6 7 v - 7- WX2 'O2 op7 G7 gh7 gh Hey, $C. ha3dipstic RA30,81,01,A45,81,01,A35,81,01, Y'know, a couple of boys from Tactical were in here earlier... yano3acupulofbosfrumtaticalwurinhererleer RA45,81,01,A40,81,01,A30,81,02, They were sayin' it was gettin' ugly in on the planet, Brimstone II. teywursainitwasgetinugliinonteplanit3brimstontoo RA45,81,01,A35,81,01,A50,81,02, The Kilrathi bases planetside are startin' to get desperate... tekilratibasisplanitsidarstartintogitdespirat A15,81,01,235,R81,01,A40,81,01,A30, Looks like the furballs're ready to try just about anything. luksliktefurbalsreditotrijustabotanitin RA40,81,01,A35,81,01,A50,81,02, One fellow said it'd all come down to supplies. wunfeloseditudalcumdawntosuplis RA45,81,01,A35,81,01,A20,81,02, If they can get enough supply ships past us to the planet... ifteycangitenufsuplisipspastustoteplanit RA45,81,01,A35,81,01,A50,81,02, ...their bases on Brimstone II might throw off our blockade. terbasisonbrimstontoomittrowofarblocaid 430,R81,01,A35,81,01,A40, Z G Z Z 78pZ Z 3NZ noZ Z Hello, $C. I was just trying to draw Casey here into a conversation. helo2dipstic5iwasjustrintodrawcasiherintoaconfursasun A45,81,01,R135,81,01,A50,81,02, We're expecting to strike a number of Kilrathi supply convoys soon... wirecspetintostrikanumburofkilratisupliconfoissoon RA30,81,01,A35,81,01,A30,81,01, I was hoping to get some advice from our quiet comrade. iwushopintogitsumadvisfrumarcwitcomrad RA45,81,01,A35,81,01,130,81,01, Shoot 'em from behind. sootemfrumbehind 430,81,02,R245,81,01,A35,81,01,A50,81,02, Their armor is weak around the engines. terarmorisweekarondtenjins R145,81,01,145,81,01,A50,81,02, Couple of good shots in the pipes... cupulofgudsotsintapips RA45,81,01,A45,81,01,A30,81,01, ...and she blows. Boom. Game over. adsiblos6boom8gamovr RA40,81,02,A30,81,01,A40,81,01,430,81,01, Z Z 2 3 f Z Z Z KLtZ Z ;NZ noZ no $C. dipstic 430,R81,01,A35,81,01,A35,81,01,A40, Colonel says we'll be going after transports soon. curnulsaswilbegunafturtransportson 115,R81,01,A35,81,01,A40, Just one thing to remember with big ships... justuntintoremimburwitbigsips RA45,81,01,A35,81,01,150,81,02, Missiles. misuls A10,81,04,R140,81,01,230,81,01,A44,81,01, Save your missiles for the mother ship. safurmisilsfortemotursip RA45,81,01,A35,81,01,A50,81,02, Your guns won't even scratch their paint... yergunswontefunscraterpant RA35,81,01,A35,81,01,A30,81,02, ...so when you're out of missiles... sowinurawtofmisils RA45,81,02,A35,81,01,A50,81,02, ...it's time to head home. itstimtohedhom RA45,81,01,A35,81,01,A50,81,02, , 2 3 4 5 P Z Z Z Z Z Z ,$IJ,KLz, Z Z 56j Z Z 0L Z uvZ Z 4I,ij,ij Mission Briefing.Chengdu System, $T hours, $D. We've got a Hornet coming in from patrol with four Krant on her tail. $C, you and Angel are going to go out and see that she gets back safe. dipstic3yewandanjulargointogoawtandsetatsegetsbacsaif 110,81,01,R140,81,01,130,81,01, It's Valkyrie, of Yellow Jacket squadron, on her way back in. itsvalkare3ufyelojacetscwadrunonhurwaibacin RA40,81,01,A30,81,01, She's got a fix on a Ralari-class destroyer in system... sesgotaficsonaralariclasdestrorinsistim A10,81,02,R140,81,01,135,81,01, ...so it's vital she get back to download her mission report. soitsfitalsegetbactodownlowdhurmisonreport 220,81,01,A40,81,01,R140,81,01,130,81,01, Computer, display Epsilon. compewtr2displaiepsilon R140,81,01,130,81,01, Here's the scenario... herstesanareo This is Valkyrie's current position. She's got a wing of four Krant on her tail... They're within 20,000 klicks and closing. You'll rendezvous with her, and cover her retreat back to the Claw. yewlrandevoowither3andcuferherretreetbactoteclaw R140,81,01,130,81,01, We need the data in her computer, so keep her safe. wenededatainhurcompewtr3sokeephursaif A30,81,01,R140,81,01,130,81,01, And remember, there's at least one Ralari in this system... andremembur3tersatleastwunralariintissistum 140,81,02,RA40,81,01, ...so stay alert out there. sostaialurtawttere RA40,81,01,A30,81,01, Questions, $C? Angel? cwestons3dipstic5anjul R140,81,01,130,81,01, No, sir. We'd better just get out there nosir4weedbeturjustgetawtter R140,81,01,130,81,01, All right then, get to work. awlrit2ten4gettowerk 140,81,01,RA40,81,01,A30,81,01, Squadron dismissed. $ 1 p F F Ks P ;V F WXu F Z ?pF F -Ww U KdF F $C U YZn F 2 ?X2 di2 2 -2 MTp F 6 2 VWw 2 VWw Mission debriefing. $T hours, $D. 1,5,4,2, Good work protecting Valkyrie, you two. She just touched down. gudwirkprotekinvalkire2utu4shejustucheddon 4,3, Good work covering Valkyrie, $C. She landed right behind you. gudwirkcoverinvalkire3dipstik4shelandedritbehinu Tactical is downloading her mission report right now... tacticalisdownlodinhermisonreportritnow RA35,81,01,A35,81,01,A30,81,02, We'll have full information on that Ralari any minute. welhavfulinformasunontatralariiniminut RA35,81,01,A40,81,01,A30,81,02, 1,9, So the hairballs got Valkyrie, eh? sotheharbahlsgotvalkire3eh That's going to cost us, $C. tatsgointocostus3dipstic 630,81,01,R125,81,01,135,81,01, Now we've got at least one Kilrathi warship loose in the system... nawevgotatlestwonkilratiwarsiplusintesistim RA25,81,01,A35,81,01,A30,81,02, ...and no idea where she is or what she's up to. andnoideawerseisorwutsesupto RA25,81,01,A35,81,01,630,81,02, 2,16,4,10, Actually, sir, we did run into the Ralari. actualy3sur3wedidrunintoteralari RA25,81,01,A35,81,01,A30,81,02, 4,11, Actually, sir, I did run into the Ralari. actualy3sur3ididrunintoteralari RA25,81,01,A35,81,01, Good. The boys in Tactical will be glad to get your data on her. gud5teboisintacticalwilbegladtogetyurdataonher A30,81,02,RA40,81,01,A35,81,01, 2,16, She won't be giving us any trouble... sewontbegivinusanitrubul RA45,81,01,A35,81,01,A30,81,02, 4,14, We scattered her atoms across the system wescaturdheratomsacrostesistim RA25,81,01,A35,81,01,A30,81,02, 4,15, I scattered her atoms across the system iscaturdheratomsacrostesisitim RA35,81,01,A35,81,01, Excellent work, $C ecselintwurk3dipstic$50 RA45,81,01,A35,81,01, I haven't seen the mission report yet, so fill me in. ihafntseentemisonreportyet3sofilmein RA35,81,01,A45,81,02,A30,81,01, 18, I got $K of the hairballs, sir... igotsevnoftehairbals3sur RA35,81,01, 19, I came up empty, sir... icaimupempti3sur 420,81,01,RA30,81,01,A40,81,01, 4,22,20, and Angel got $L. andanjilgotsevn 240,81,02,RA30,81,01,A35,81,01, 21, and Angel was blanked. andanjilwusblancd 220,81,01,430,81,01,RA40,81,01, 4,22, And the Kilrathi got Angel. andtekilratigotanjil 430,81,02,R425,81,01,A35,81,01,A30,81,02, I see... isi RA25,81,01,A35,81,01,A50,81,02, 24, I'll want to see you in my office later on, $C. ilwanttosiyuinmiofislaturon3dipstic RA45,81,01,A35,81,01,A30,81,02, That'll be all then, dismissed. tatsalten4dismised 2 - P 2 p q 2 D2 Z2 ,2 LM2 2 $Mj2 2 So, $C. Here we are in the Chengdu system. so2dipstic4herwearintesingtusistim RA35,81,01,A25,81,01,A30,81,01, Ever been to the planet Nanjing, before? efurbintosingtubefor RA45,81,02,A25,81,01,A30,81,01, Wonderful place. Not a single higher animal native to the planet. wondufulplais5notasingulhieranimulnatiftoteplanit RA35,81,01,A30,81,01, But it makes up for that with bugs ... big ones. butitmaiksupfortatwitbugs5bigwuns RA35,81,01,A45,81,01,A30, They got six-foot-long huntin' insects in the forests... teygawtsicsfutlonhuntininsectsinteforists A10,81,01,RA35,81,01,A30,81,01, Colonists call 'em bugbears, and they stay clear of them. cawlonistscalembugbers3anteystaicliroftem RA40,81,01,A30,81,02,A45,81,01, No idea why anyone'd settle here. noideawhianiwundsetulhir RA30,81,01,A40,81,01, They say there's lots of hydrocarbons... teysaiterslotsofhidrocarbons RA40,81,02,A25,81,01,A35,81,01, ...but it just don't seem worth it to me, with all them bugs butitjustdontseemwurtittome3witaltembugs RA35,81,01,A40,81,01, 2 2 C D 2 2 ;y2 42 TUk2 2 Ah, bonjour, $R. a3bansur2kaptan RA45,81,01,A35,81,01,A50,81,02, I have been reviewing our data on the Kilrathi starfighters. ihavbanravuagardataantekalratestarfitrs RA45,81,01,A35,81,01,A50,81,02, Our information indicates that in all cases... aranformatanandakatstatanalcasas RA45,81,01,435,81,01,A50,81,02, ...their side armor is weaker than that to the front or rear. tarsidarmraswekrtantatutefranarrer RA45,81,01,A35,81,01,A50,81,02, 0,6, Making it doubly foolish to close head on, into the enemy's guns. maikinitdublifoolistocloshedon3entewtenemisguns 240,81,02,R145,81,01,A35,81,01, Indeed, mademoiselle. indeed3madamosel 140,81,01,RA45,81,01,A35,81,01, The best attack line would be from the flanks. tebestataclinwudbefrumteflanks 140,81,01,RA45,81,01,A35,81,01, 2 5 2 X Y 2 W2 wx2 Lw2 2 a2 2 B2 B Konichi-wa, honorable $R. conisiwa3honorabldipstic 45,81,02,430,R81,01,A35,81,01,A40, Captain Devereaux and I were just discussing the enemy's shields. captindeverowandiwerjustdiscusinteenimisselds A10,81,01,235,R81,01,A45,81,01,A35, She was pointing out an excellent tactic I have used myself. sewaspointinawtanecselentacticihafusdmiself RA45,81,02,435,81,01,440,81,02, When tailing the enemy, it is good to fire several volleys of lasers... wintailinteenemi3itisgodtofirsefrulvolisuflasers R81,01,A35,81,01,A40, ...while keeping an eye on his sheilds in your targetting computer. whilkepinanionhissildsinyurtargatagcamputr RA30,81,01,A35,81,01,A50,81,02, Once your lasers have brought his shields down... wunsyerlasurshafbrawthissildsdown R145,81,01,A35,81,01,A50,81,02, ...then fire a heat-seeking missile to finish him. tenfiraheetseekinmisiltofinishim RA45,81,01,A35,81,01,A50,81,02, Data indicates a missile is over twice as likely to destroy a fighter... dataindicatsamisilisofurtwisasliklitodistroiafitur 420,R81,01,A45,81,01,A35, ...if it hits when her shields are down. ifithitswinhursildsardown RA45,81,01,A35,81,01,A30,81,01, F g r q e 2 3 d 4 5 V W Z X Z Z W Z Z 9P Z pq , , , Z ? F Z NZ Z 67 Z 1 Z QR Z Z PQj Mission Briefing. Chengdu System, $T hours, $D. Ten minutes into the briefing... 4,3, Next up is Iota Wing, $C and Angel. necstupisiotawin3dipsticananjil 4,4, Next up is Iota Wing. $C, you'll be flying solo this time. necstupisiotawin5dipstic3yewlbeflinsolotistim We've got an Exeter-class destroyer that's headed for Ymir System. wefgotaecksetirclasdistrortatshedidforimirsistum R130,81,01,140,81,01, You'll fly escort as it heads for its jump point. yewlfliescortasithedsforitsjumpoint RA45,81,01,A35,81,01,150,81,02, Let's take a look at the screen... letstaikalookatescreen RA45,81,01,A35,81,01,A50,81,02, Computer, display Iota. camputr3daspladalta The jump point is here, at Nav 1. Look alert out there, as you may need to guide the destroyer. We have detected several asteroid fields in the area... ...and we believe there may be Kilrathi fighters nearby as well. andwebeliftermaibekilratifitursnerbiaswel RA45,81,01,135,81,01,A50,81,02, Questions? cwestuns 145,81,01,135,81,01,R250,81,02, 4,14, Oui, mon colonel. Is it safe to take an Exeter through such asteroids? we2moncolonel5isitsaiftotaikaventurtrusucastrods A5,81,01,R135,81,01,A30,81,02, 4,15, Yes, sir. Is it safe to take an Exeter through asteroids like that? yes2sir5isitsaiftotaikaventurtruastrodsliktat A5,81,01,R135,81,01,A30,81,02, We've plotted a safe course through the asteroids for the Exeter... wefplotedasaifcorstruteastrodsforteventur 130,81,01,RA40,81,01,A50,81,02, ...but you'll need to be alert for ambush from among the debris. butyewlnedtobealurtforamusfrumamontedebri RA30,81,01,225,81,01,A40,81,01, Ordinarily, we'd fly around the asteroids... ordinarili3wedfliarondteastrods RA30,81,01,A25,81,02,A50,81,01, ...but that destroyer has to be at Ymir too soon to allow the longer route. buteventurhastobeatimirtosontoalowtelongrroot RA40,81,01,A35,81,01, Anything else? anitinels RA40,81,01,A35,81,01, All right, then. Squadron dismissed. $ x - Q i Z j k Z Bc Z Z CuZ Z 92 Z 7 Z MTZ 'Z GHqZ Z ABsZ Z ? Z 32 STep Z 2 6Y2 Z2 2 Z Z HMw2 Z Z Mission debriefing. $T hours, $D. 2,10, So the Exeter jumped out all right? sotecsitarjamptawtalrit Yes, sir. We ran into that Kilrathi ace, Dakhath, and a wing of Dralthi... yes2sur4weranintotatkilratiais3dacas4andawinufdralti RA45,81,01,A35,81,01,A50,81,02, ...but we held them off until the destroyer got away. butweheldemofuntilteventurgotawa A45,81,01,A35,R81,02,250,81,01,235, Dakhath, eh? I'd heard he might be in system. dacas3ai5ifhurdhemihtbeinsistum 125,81,02,130,R81,02,A45,81,01,A35, Good work, keeping him off the Exeter. What happened to him in the end? gudwurk3keepinhimofteventur6wuthapendtohiminteend RA45,81,01,A35,81,01,A50,81,02, 1,8, We got him, colonel. Blew him to little bits. wegotim3cernul5bluhimtolitulbits$20 RA45,81,01,A35,81,01, Excellent I'll see that the brass hears about this exsulint$5p2ahlsetattebrasherabottis A45,81,02,RA35,81,01,A40,81,01, 1,10, He got away, sir. I'm sorry. hegotawai2sur4imsori RA45,81,01,A35,81,01,A50,81,02, Oh, well. At least we're certain he's in the system now. o2wel4atlestwersirtinhesintesistumnaw RA45,81,01,A35,81,01, 2,19, I understand the Exeter didn't make her jump. iundurstandteventurdidnmaikhurjump RA45,81,01,A35,81,01,A50,81,02, 0,13, No, sir. She didn't even make it to the jump point... no3sur6sediduntevenmakittotejumppoit 415,81,01,R435,81,01,A40,81,02, We lost her in the asteroids on the way. welostherinteastrodsontewai RA35,81,01,A25,81,01,A20,81,02, 0,19, No, sir. We ran into a squadron of Dralthi at the jump point. no3sur4weranintoascwadrunofdraltiattejumppoint RA35,81,01,A25,81,01,A40,81,01, That Kilrathi ace, Dakhath was leading the wing. tatkilratiais3dacas2wasledintewin RA35,81,01,A25,81,01,A40,81,01, We never had a chance, sir. There were just too many of them. wenefurhadacans2sur4terwerjusttomanioftem R435,81,01,A25,81,01,A40,81,01, Dakhath, eh? I guess its no surprise that we lost the Exeter, then. dacas3a2p3igesitsnosupristatwelostteventur3ten A10,81,01,730,81,01,RA25,81,01,A40,81,01, You're awfully lucky to have made it back yourself. yurawfulylucitohafmaditbacyurself RA35,81,01,A25,81,01,A40,81,01, I know, colonel. ino3cernul RA35,81,01,A25,81,02, Well, let's hit the numbers on the mission report. wel3letshittenumbursontemisonreport RA45,81,01,A35,81,01,450,81,02, 21, Recorder shows $K Kilrathi destroyed by you, $C... compewtrsowssefnkilsforyew3dipstic 22, Recorder gives you no kills, $C... compewtrgifsyewnokils3dipstic 4,25,23, and $L for Angel. ansefunforanjil 24, and none for Angel. 4,25, And Angel didn't make it back. andanjildiduntmaikitbac RA45,81,01,A35,81,01,A50,81,02, 26, I want to see you in my office later, $C. iwantoseeyewinmiofislatur3dipstic RA45,81,01,A35,81,01,A50,81,02, Yes, sir. yes2sur RA35,81,01,A40,81,01,A50,81,02, All right, then. Dismissed. 2 7 Z 2 2 R2 2 23h2 2 Jw2 Jw You hear what they're sayin' in Blue Devil Squadron? yewhirwuttersaininbludefulscwadrun 245,R81,02,A45,81,01,A35,81,01,A50, Word is, one of their boys ran into Dakhath on patrol yesterday. wurdis3wonofterboisranintodachatonpatrolyesturda RA45,81,01,A35,81,01,A50,81,02, You know Dakhath, right? The Kilrathi ace that flies a Dralthi? yewnodakhat3rit5tekilratiaistatflisadralti RA30,81,01,A35,81,01,A40,81,01, He's got 78 confirmed kills, countin' fighters an' capital ships. hesgotsavntiatcanfrmdkals3contnfitrsancapatalsips RA35,81,01,A25,81,01,A40,81,01, They say his name means Deathstroke' in Kilrathi... taysayhistaimmensdetstrokinkilrati RA35,81,01,A25,81,01,A40,81,01, ...'cause how he gets his jollies. cawshowhegetshisjolis RA45,81,01,655,81,02,A30,81,02, He likes to shoot pilots who've ejected as they wait for a pick up. helikstosootpilotshofejectidasteywatforpicup R645,81,01,635,81,01,A50,81,02, 2 ; d 2 92 YZ2 2 So, $C. You've heard about that new fighter, the Rapier? so2dipstik5yufhurdabotatnewfitur3terapir RA45,81,01,A35,81,01,A50,81,02, You nod as you sip your drink. RA45,81,01,A35,81,01,A50,81,02, I read that we're getting the first Rapier squadron on active duty. iredtatwirgetintefurstrapirscwadrunonactifduti RA45,81,01,A35,81,01,A50,81,02, Colonel's already named the squadron Black Lion... cernulsalredinaimdtescwadrunblaclion RA45,81,01,A35,81,01,A50,81,02, I wonder who'll be assigned to it? iwundurwholbeasindtoit 245,81,01,235,R81,01,A50,81,02,A35, 2 3 S 2 s t 2 H2 hi2 .2 NOr2 2 32 3 Lot of talk going around about this Dakhath guy. lotuftalkgoinaronabottisdacatgi R145,81,01,A35,81,01,250,81,02, Well, don't sweat that fuzzball too much. weldontswetatfusbaltumuc R245,81,01,235,81,01,A50,81,02, Casey ran into Dakhath a couple of years ago, near Planck's Star. casiranintodacatacupulufyirsago4nirplancsstar RA45,81,01,135,81,01,A50,81,02, Dakhath got his rep by shooting helpless men... dacatgothisrepbisootinhelplismen 145,81,01,635,81,01,RA50,81,02, ...but he's not so tough if you stay in your ship. buthesnotsotufifyurstilinyersip RA45,81,01,A35,81,01,A50,81,02, Watch him when you're on his tail. wathimwinyeronhistail RA45,81,01,A35,81,01,A50,81,02, He likes to burn out... helikstuburnawt RA25,81,01,A35,81,01,A40,81,01, ...or drop behind you with a kickstop. ordrapbehandyuwitakikstap RA35,81,01,A30,81,01,A50,81,02, B 4 5 6 7 Q g Z h i Z Z r Z Z ,-Oc, LM mn Z Z 12Uj Z Emergency Briefing.Chengdu System, $T hours, $D. Code Red alert, everyone. wegatacodradalrt3pepl We've got six Kilrathi Gratha headed for the Tiger's Claw. wefgotsicskilratigratahedidfortetigursclaw You Killer Bees are the only squadron available... yewkilurbeesarteonliscwadrunavalabul ...so you're going to have to stop them before they can blow the Claw. soyurgointohaftostoptembeforteycanbloteclaw They've already taken out one of the two Hornets flying guard... teyfalreditakenawtonuftetoohornitsflingard RA45,81,01,135,81,01,A50,81,02, ...so we know they mean business. sowenoteymeenbisnis RA45,81,01,A50,81,02,240,81,01, 4,8, $C, you and Angel will be first to launch. R145,81,01,135,81,01,150,81,02, 4,9, $C, you'll be first to launch. R145,81,01,135,81,01,140,81,01, Hunter and Redbird will take the next launch... RA45,81,01,A35,81,01,A50,81,02, ...then Maniac and Turtle, if they haven't disabled the launch tube. R220,81,01,A30,81,01,A25,81,01, Take this one personal, people... taiktiswunpersonal4peepol R245,81,01,A35,81,01,130,81,01, They're after YOUR ship this time. terafturyersiptistim RA45,81,01,135,81,01,A50,81,02, Now let's get into space Squadron dismissed $ - ; J Z K Q Z Z 28 w P ,px $5 Z UVr 7 Z gZ 7 7 ABiZ Z Z 5Z 6;O Z dZ Z 1 Z 1 Mission debriefing. $T hours, $D. 50,6, Good job, $C. gudjab3dipstik 4,3, You and Angel really made the difference out there yewandanjilrilimadtediferunsawter A45,81,03,RA35,81,01,A50,81,02, Hunter deserves just as much credit, sir. hunturdisurfsjustasmucredit4sur RA45,81,01,A35,81,02,A50,81,01, 4,5, Oui, mon colonel. They were in space before the last four Gratha got here. wi2moncolonel4teywurinspaisbefortelastforgratagother 125,81,02,RA30,81,01,A45,81,01, You people managed to turn the Gratha before Maniac could even launch yupepolmanajdtoturntegratibeforjokurcudevenlonc RA35,81,01,A40,81,02,A20,81,01, 50,13, Glad to see you made it back, $C. That was pretty messy out there. gladtoseyumaditbac3dipstic5tatwaspritimesiawter RA30,81,01,A40,81,01,A25,81,01, How's the carrier, sir? howstecarier3sar RA25,81,01,A35,81,01,A40,81,02, She took some bad hits, $C. setoksumbathits3dipstic RA45,81,01,A35,81,02, They went straight for the launch tubes. teywintsraitfortelawnctoobs RA45,81,01,A35,81,01,A50,81,02, That's why we never got Hunter and Redbird into space. tatswhiwenefurgotjokurandturtulintospais RA45,81,01,A35,81,01,A40,81,01, Well, at least we survived the attack... wel3atlestwesurfifdteatac RA35,81,01,A35,81,01,A40,81,01, 4,13, All except Angel, that is. alecseptanjil3tatis 440,81,02,RA35,81,01,A40,81,01, We've already gotten a mission report. wefalredigotenamisonreport RA45,81,01,A35,81,01,450,81,02, 15, You racked up $K, $C... yuracedupsefn3dipstic 16, Nothing for you, $C... notinforyu3dipstic 4,18,17, and Angel got $L. andanjilgotsufn 18, and none for Angel. andnunforanjil 20, I want to see you in my office later, $C. iwantoseeyuinmiofislatur3dipstic RA45,81,01,A35,81,01,A50,81,02, Yes, sir. yas3sur RA35,81,01,A33,81,01,A40,81,02, All right, then. Dismissed. tatsalten4dasmasd 7 C o 2 2 c7 2 $G2 uv7 4Q7 qr7 E7 E Knight tells me the colonel's movin' you to Blue Devil Squadron. nittelsmetecernalsmofinyutobludefilscwadrun 245,R81,02,A45,81,01,A35,81,01,A50, That'll put you on a Scimitar, like I flew when I was your age. tatalputyuonasimitar3likifluwiniwasyuraj RA45,81,01,A35,81,01,A50,81,02, Darn fine ship in her day, though she looks a little outdated now... darnfinsipinhurdai3toseloksalitulawtdatidnaw RA35,81,01,A40,81,02,A50,81,01, The Scimitar mounts a pair of mass driver cannons... tesimitarmontsaparofmasdrifurcanon 235,R81,01,240,81,01,A50, ...instead of the Hornet's lasers. instedoftehornitslasurs RA35,81,01,A50,81,02, They fire a lot farther than laser bolts, and hit with more punch... teyfiralotfurturtanlasirbolts4anhitwitmorpuns RA45,81,01,A35,81,01,A50,81,02, ...but the projectiles move a lot slower. butteprojectilsmofalotslowur RA30,81,01,A35,81,01,A40,81,01, That makes you use 'em closer up, in spite of the extra range. tatmaiksuusmclosrup3inspitofteextrarainj RA45,81,01,A35,81,01,A50,81,02, Still, those extra klicks are good against big, slow ships, like tankers. stil3tosecstraclicsargudaginstbig3slosips4liktankurs$99 RA40,81,01,A30,81,01,A35,81,01, 2 Q 2 q r 2 Lw2 2 T2 7 S7 7 Hey, $C, you hear about the new assignments? hay2dipstik2yuhirabottenuasinmits RA45,81,01,A35,81,01,A50,81,02, The colonel said he's moving you to a Scimitar in Blue Devil Squadron. tecernalsedhesmofinyutoasimitarinbludefulscwadrun RA45,81,01,A35,81,01,A50,81,02, Ever flown Scimitars before? I think you're going to like them. efurflonsimitarsbefor5itincyergointoliktem RA45,81,01,A35,81,01,A50,81,02, A Scimitar isn't quite as fast or nimble as a Hornet... asimitarisntcwitasfastornimbulasahornet RA45,81,01,A35,81,01,A50,81,02, ...but she's got twice the armor, as well as heavier guns. butsesgottwistearmor3aswelashefierguns RA45,81,01,A35,81,01,A20,81,02, And she handles like a Centaurian mud pig. andsehandulslikasintarianmudpig 240,81,01,R240,81,01,A50,81,02,A35, Iceman here'll try to tell you speed and handling'll save your butt... ismanherltritutalyuspedadhadlaglsavyurbat 140,81,01,RA45,81,01,A35,81,01, ..but I'll take an extra three centimeters of durasteel plating any day batiltakanakstrtreanjsafdurastelplataganeda RA45,81,01,A35,81,01,A50,81,02, 2 0 2 P Q 2 2 Q7 2 82 XYy7 7 $C. They call me Iceman. dipstik8tacalmeisman RA45,81,01,A35,81,01,A50,81,02, Don't let Knight here fool you about the Scimitar. dontlatnitherfulyuabowttesamatar RA45,81,01,A35,81,01,A50,81,02, It's a gun-heavy slug. atsaganhaveslag RA45,81,01,A35,81,01,A50,81,02, Forget finesse in a Scimitar.Just head straight in, guns blaring. forgatfanasanasamatarp6jashadstratan4gansblarag RA45,81,01,A35,81,01,A50,81,02, Give me a ship that lets me use my skill... gavmeasaptatlatsmeusmiskal R145,81,01,A35,81,01,150,81,02, A Raptor, even a Hornet... araptor3evnahornat RA45,81,01,A35,81,01,A50,81,02, ...or one of those new Rapiers orwanaftosnurapears RA45,81,01,A35,81,01,A50,81,02, If half of what they say is true, the Rapier's a true artist's ship afhafafwattasaastru5terapearsatruartastssip RA45,81,01,A35,81,01,A50,81,02, 9 o v ' S T U V Z Z S Z 6 9vF P Tj F d wqrwstwwRSwTU P P P P D d qr d qr Mission Briefing.Dakota System, $T hours, $D.Twenty minutes into the briefing. As you may have heard, there's been an outbreak of Watson's Disease here. It's spreading across the fourth planet, Fargo, like wildfire. atsspradagakrastefortplanat2fargo2likwildfir If we don't get a vaccine down there soon,that colony's history. ifwedongatavaksendontarsun3tatcalaneshistore RA45,81,01,A35,81,01,A50,81,02, We've been ordered to provide primary cover for medical transports. wevbanordardtuprovidprimarecavrformadakaltransports RA45,81,01,A35,81,01,A50,81,02, Your job will be to cover the Draymans as they come and go. yorjabwilbitocafirtedramansateycamango RA45,81,01,A35,81,01,A50,81,02, Gamma wing will consist of $C and Knight. gamawinwilcansitafdipticankniit RA45,81,01,A35,81,01,A50,81,02, I'm counting on you two to come through... amcantinanututocamtru R81,01,A35,81,01,A30, ...and so are the colonists down on Fargo. ansoartekalanisdonanfargo RA35,81,01,A35,81,01,A40,81,01, Computer, display Gamma. camputir3displagama R125,81,01,140,81,01, You will proceed first to Nav 1, escorting an outbound hospital ship. Your objective is to protect her from the Kilrathi until she makes her jump out. Once she's gone, go to Nav 2, where you'll rendezvous with another 'sport. Bring this Drayman back to the Tiger's Claw in one piece... ...she's the one carrying the vaccine for Fargo. Any questions? anicwatans RA35,81,01,A30,81,01, No, sir. no3sar RA35,81,01,A35,81,01,A50,81,02, None here, Colonel. nanir3cernal RA25,81,01,A40,81,01, Very good. That's all gentlemen. farigud5tatal3jintalman RA5,81,01,A10,81,01, Dismissed. d $ X v Z Ut Z Em Z F Z cZ - Z MNF 2 -234Z 56xF Z 3j Z Z 12p Z d ?Dqd rwd d Z WA -d CDOWd CDOW Mission debriefing. $T hours, $D $C, it's good to see you. Let's have your report. diptic3itgudusiu5letafurepart RA45,81,01,A35,81,01,A40,81,02, 1,13, Yes sir. We ran into bogies at Nav 1, but we took care of them. yasar4wirantubogesatnafwan3batwitukaraftim RA45,81,01,A35,81,01,A50,81,02, The Drayman's on her way to her destination tedramansanirwaitoirdestinasan R81,01,A40,81,01,A50,81,02, 1,6, We ran into heavy fighter cover at Nav 1, sir. weranantuhavefitrcavratnavwan2sar RA35,81,01,A40,81,01,A30,81,01, We lost the Drayman in the battle. She didn't make her jump. welastedramanantebatlp4sedadnmakharjamp RA35,81,01,A40,81,01,A50,81,02, I see, $C. What about the inbound Drayman? asi3dipstik5wataboteinbandraman RA35,81,01,A40,81,01,A40,81,01, 4,13, She should be in formation now, sir. sesudbeinfarmasanawsar RA35,81,01,A30,81,01,A40,81,02, 7,10, It seems that Knight couldn't handle it, $R. iteemsatniitcoodinandalit5dipstic RA35,81,02,A30,81,02,A40,81,02, He did his job, sir. He helped bring the Drayman home. hedidisjab3sar6hehelprintedramanom RA45,81,01,A35,81,01,A50,81,02, That's true. And that vaccine will save thousands down on Fargo. tatru5adtatvaksenwalsavtosansdonanfargo A5,R81,01,A35,81,01,A30,81,01,A40, That's what matters, Colonel. tatswatmatrs2kernal RA45,81,01,A35,81,01,A50,81,02, 18, We were jumped by a wing of Jalthi, sir. They trashed the 'sport. wiwarjamptbiawinafjaltisarp5tatrasdtesport R435,81,02,A35,81,01,A50,81,02, 7,15, Those damn furballs took out Knight, too. tosdamfarbalstukawtniit3tu 640,81,01,630,R81,01,A35,81,01,A40, 7,16, We barely got out of there with our lives, sir. webarligatawtafterwitarlifs3sar A20,R81,01,A35,81,01,A40, Dammit, $C. Fargo was depending on those medical supplies. damat2dipstikp4fargowasdepadagantosmadacalsaplis R645,81,01,635,81,01,640,81,02, well, maybe we can get another hospital ship there in time... wal2mebewekangetanatiraspitalsipterintim 620,R81,01,A35,81,01,A40,81,01, I've reviewed your flight recorder's report of your mission, $C. ifredecamewtarepartafurmisan3diptic RA35,81,01,A35,81,01,A25,81,02, 20, You shot down $K, $C... usatawnsefan3dipstic 21, You didn't score at all, $C... udidantoratal3diptic 22, and Knight ripped $L. aniitriptpusi 23, and Knight didn't take any out. aniitidantaikaniawt I'll need your written report concerning the transports by 0800, $R. alnidurwritinreparconsirnintetranspartbiohaitandrid3diptic RA45,81,01,A35,81,01,A50,81,02, 25, Oh, and $C...come see me when you're done with your post-mission duties. o3andiptic4camsimiwinurdanwiturposmisandutis R81,01,A35,81,01,A40, Dismissed. dasmast P 2 Z 2 Q2 gh7 Iz2 2 Hey, $C. Glad to see you again. ha3dipstic5glatosiuagin RA45,81,01,A35,81,01,A40,81,02, We just jumped in to Dakota System, you know. wejasjampdintudakotasastam2yuno RA30,81,01,A35,81,02,A40,81,01, It's basically an agro colony, but they've had an outbreak of Watson's Disease. itbasiclianagrocalani3battavhadanowtbrakovwatsansdises R81,01,A35,81,01,A30, The colonists here're a proud bunch, an' they waited to call for help. tecalanastsheraraprodbanj2antawatadtucalforhalp RA45,81,01,A35,81,01,A50,81,02, That's bad news. Watson's can wipe out a whole city in just a few weeks. tatsbadnusp4watsanscanwipowtaholciteanjasafuweks 220,R81,01,A35,81,01,A40, There's no cure yet, but the Confederation's 'sportin' in a vaccine. tarsnocuryat3battecanfadaratanssportananavaksen RA35,81,01,235,81,01,A45,81,01, 7 J v 2 F ;Q2 uv2 2 7 ?A 2 o2 o 6,6, C'mere, mate. Maniac's teachin' me 'ow to fly. Can you believe it? camer2dipstic5manicticinmitufli5canubilifit A20,81,01,225,R130,81,01,A35,81,01, Someone better -- you're dangerous, and not just to the Kilrathi. samwanbetar5urtanjiras3anotustotekilrati R230,81,01,225,81,01, I'm dangerous? I'm dangerous amdanjiras4amdanjiras 535,81,01,645,R81,01,135,81,01,A50, This from the guy who goes to afterburners the instant 'e smells a target tisframtagiwugosaftirbernerstaintantismelsatarget RA45,81,01,A35,81,01,A50,81,02, Well, at least I go after 'em. Some of you old guys don't always do that. welatlistagoafturem5samofuawlgisdonalwaisdotat R220,81,01,A25,81,01,A20,81,01, I 'ate to admit it, mate, but you're right about some of the old guys.' ihaitoadmitit4buturitabotsamafta2oldgis R140,81,01,135,81,01,A30,81,01, Knight, Paladin, some others, they must be cat lovers...or pacifists. niht3paladin4samaters4teymutbecatlafers5orpasifiss RA45,81,01,A35,81,01,A40,81,01, But don't lump me with that lot, mate. batdonlapmeanwattatlat2mat RA35,81,01,235,81,01,A40,81,01, The more Kilrah blood I smell, the nastier I get. temorkalrabladismal3tenastearigat RA45,81,02,A50,81,01,A30,81,01, 2 ? k 7 2 VF 2 .V7 pv2 L7 lm2 e7 7 7 Hey, $C? I feel like griping about wingmen. Care to join in? ai2dipstic4ifilikripinabotwinmin4cartujanin 110,R81,01,120,81,01,115, Take Knight, for example. He flies like an old lady. No vision... taknit2forisamal3hiflislikanaldladi5nofison 215,R81,01,A25,81,01,A30, ...and he couldn't find a target if his wingman's life depended on it. anicudantfinatargitifiswinmanlifdepidadonit R120,81,01,110,81,01,130,81,02, 1,4, Which it usually does... wijisusalidos R135,81,01,130,81,01,A40,81,01, Yeah. And Angel...Always studying, planning. Just fly, I say. ya5ananjil3alwasudin2planin5jastfli2asi 210,R81,01,A25,81,01,120, 6,7, Anybody on the the Claw you don't mind flyin' with, squirt?. $5anibadintaclaudanminflinwit3swirt 130,R81,01,135,81,01,150, First off, let's watch the squirt cracks. And second... firsaf2letwateswirtcracs5ansecand R120,81,01,125,81,01,A20,81,01, 'Course there're a couple of pilots I don't mind flying with. cortersacapalofpilatsidanminflinwit RA15,81,01,125,81,01,A30,81,01, You're not too bad, Hunter -- almost as good as me. And there's Iceman... yernatubat2antar3almotasgudasmi5anersisman R220,81,01,A25,81,01,130,81,03, Ice is scary, man. I mean, I'm in this for the flying... asiscari4man6imin2amintisfoteflin 410,R120,81,01,A25,81,01,111, He's in it for the killing, I think. hisinitfortakilin3itin R410,81,01,A25,81,01,A20,81,01, 9 V 1 2 3 4 U V K W X K F UV K 9c U .P OPeu F d ? ,7 89wx xy Fu Mission Briefing.Dakota System, $T hours, $D. Ten minutes into the briefing... ...which brings us to our patrol wings. wicbrinastoarpatralwins Lambda wing will fly a three point patrol. apalanwinwilfliatrepanpatral Things have been quiet lately...too quiet. tinsafbincwietlatli4tucwiet RA45,81,01,235,81,01,A50,81,02,135,81,01, The Kilrathi are definitely out there. Problem is, we don't know where. tekilratiardefinatliawter5prablimis3widanowar R135,81,01,A50,81,02,240,81,01,A45,81,01, Your job will be to locate the enemy and report back to the Claw. urjabwilbetolocatenimianrepartbaktuteclaw R240,81,01,A45,81,01,135,81,01,A50,81,02, 7,8, $C, you and Knight will investigate. $C will lead the mission. R245,81,01,235,81,01,250,81,02, 7,9, $C, with Knight gone, you'll take this patrol alone. R245,81,01,235,81,01,250,81,02, Understood, Colonel. anartood3kernal R245,81,01,235,81,01,250,81,02, Your patrol will be as follows... urpatralwilbiasfalows Computer, display Lambda. campewtir3displaipsilan R130,81,01, As you can see, there's not much to go on... There's some debris near Nav 1. Could be rocks, could be mines...stay alert. The jumppoint at Nav 2 seems to be clear... sobeantelukowtforadatanalboges As does Nav 3. Make the rounds and return with your report. sobeantelukowtforadatanalboges Unless you have questions, that's all. anlisuafcwastans3tatal Are we cleared to engage any targets we sight, Colonel? arwiclirtoingajanitargitwisait3kernal R245,81,01,235,81,01,250,81,02, Definitely. Use your judgement, though. I don't want to lose any more pilots. defaniti5usurjadmin3to5idanwantulusanimarpilat 215,81,01,235,R81,01,A40, Squadron dismissed. $ , Z QZ Z b Z Z 1gZ 7 AZ Z 7 JOv7 wA 7 Z 2QK qv,, Mission debriefing. $T hours, $D. 7,2, Welcome back, gentlemen. What is the situation? welcamak3jintilman5watitesituatan RA35,81,01,A40,81,01, 7,3, Welcome back, $C. What's the situation. welcambak3diptic5watesituatan RA35,81,01,A40,81,01, 0,4, There was a welcoming commitee among the rocksat Nav 1, but they aren't going home. terwasawelcamincamitiamagteroksatnavwan3bateyarngoinom RA35,81,01,A40,81,01, 1,7, We spotted a Ralari-class destroyer at Nav 2. witenincantirdaralariclasdistroiratnaftoo RA35,81,01,A40,81,01, 2,8, She and her escorts gave us some trouble, but we took her out in the end. segafasamresisans3alanwitirescarts4batwitukerawtinteend RA35,81,01,A40,81,01, Excellent, $R. That's the kind of report I like to hear. ecselant3dipstic5tatekindafripartilaktoir RA35,81,01,A40,81,01, 0,11, Nothing much to report, sir. No sign of the Kilrathi. nathinmuchtoreport3sahr4nosinofthekilrate 2,11, We tried to get in for the kill, sir, but they fought us off. wetridtogetinfartekil3sar3bateyfawtasaf RA45,81,01,435,81,02, I see. We'll send a strike wing after her. ise3welsanastikwagaftrhar RA45,81,01,A35,81,01,A50,81,02, Still, sir, I'd have rather taken her out. stil2sar3idafratirtakinerawt RA35,81,01,A25,81,01,A30,81,02, Let's go over your flight recorder data. letgoofirurflitrekardirdata RA45,81,01,A35,81,01,420,81,01, 13, You got $K, $C. vreenkalsforyu2dipstik 14, You washed out, $C... usukdik3diptic 7,16,15, and Knight scragged $L. aniitscragtepal 16, and Knight struck out. aniitstukawt 2,17, Again, good job on destroying that Ralari. agin3gudjabandistroiinteralari RA45,81,01,A35,81,01,A50,81,02, 18, And $C ... come to my office in an hour. andipstik4cumtumiafisananowr RA45,81,01,A35,81,01,A50,81,02, Dismissed. dasmasd 2 5 2 Y Z 2 2 KLu2 2 A2 92 2 K2 K $C You're big news lately. dipstic6yurbagnuslatli 245,R81,02,A45,81,01,A35,81,01,A50, Heard you had to take out some Krants last time out. herduadutaikawtsamkrantlatimawt RA40,81,01, Glad to see you made it back in one piece. Those babies can be tough... glatusiumaiditbakinwanpis5tosbabiscanbetaf R81,01,A35,81,02,A50,81,02, ...but I hear the Jalthi's even tougher. butihirtejaltisefintafr A45,81,01,A35,R81,01,240,81,01,A30, One of those six-shooters on your tail, you can kiss it goodbye. wanaftossaksutrsanyurtal3yukankasatgudbi A45,81,01,A35,R81,01,240,81,01,A30, But I'll bet if you get low an' behind a Jalthi, you'd toast it. batalbatafyugatloanbehinajaltep3yudtostat A45,81,01,A35,R81,01,240,81,01,A50, She's got no rear visibility, and big ol' bullseye exhausts. sesgatnorervasabalatep3anbagolbulsieksasts A45,81,01,A35,R81,01,240,81,01,A50, Bad design no matter how many guns she's got up front. badesinomatirawmanigunsyagatapfrant A45,81,01,A35,R81,01,240,81,01,A50, Just jam a missile up those rear pipes and -- BOOM No more kitty. jusjamatorpaptosrirpipsan2booom5nomorkiti A45,81,01,A35,R81,01,240,81,01,A50, K K K L z K ,K FGK MK ghK KpK K Hey, $C. Have a seat. hai3diptic5hafasit RA45,81,01,235,81,01,A50,81,02, I've heard some talk lately that burns me up. ifharsamtalklatlitatbarnmiap 210,81,01,630,R81,01,A35,81,01,235, Someone's saying I'm unsafe to fly with...and that I'm a cat-lover. samwanssaagimansaiftofliwit3antatimacatlavr 235,81,01,635,R81,01,A50, Well, I won't stand for that kind of slander. It's not true. wel3iwanstanfartatkindafslandir5itnatru RA45,81,01,235,81,01,A50,81,02, I may not be as high-flying as Hunter, but I get the job done...in one piece. imainatbeashiflinashantir3batigitejabdan4inwanpis 220,R81,01,235,81,01,A35, But hey, you're not the guy to complain to...after all, we've flown together now. batey3urnategitucamplintu3aftiral3wiflowntogetarnaw R245,81,01,A35,81,01,230,81,01, You know you can count on me. It's just a matter of trust. unoucancawntanmi5itjastamatiraftrust R245,81,01,A35,81,01,A50,81,02, Thanks for the shoulder, $C. tanksfortesoldr3diptik RA45,81,01,435,81,01,250,81,02, K J K K fK K $gK K ;K K fK K 7,1, Join me, $C. Knight is poor company and I feel the need to talk... jonmi3dipstic5niitisparcampiniandifiltenidtotalk R145,81,01,235,81,01,A50,81,02, 7,2, Welcome, $C. Join me won't you? I am in need of company... welcam3disptic5joinmiwontu5iamineedafcampani R145,81,01,235,81,01,A50,81,02, I have been studying the history and progress of the war... ihafbinstudintehisorianpragresaftewar R145,81,01,435,81,02,130,81,01, ...and I see that things are going fairly well for us. anisetatingsargoinfarliwelfaras 110,R81,01,A35,81,02,140,81,03, To maintain our position, we must be ever diligent, ever alert... tomantanarpositan4anmusbeeferdilijint3efaralart RA35,81,01,135,81,01,130,81,01, We must fight as if there were no tomorrow, for in truth... wimusfitasifterwernotomarop3forintrut R145,81,01,A35,81,01,A50,81,02, ...that is the case.Every day, the Kilrathi bring up more troops. tatistecas4efridai3tekilratibrinupmortrups RA45,81,01,135,81,01,120,81,01, They challenge us harder each time we fly. teycalanjashardireectimwifli R81,01,135,81,01,A30, The very future of humanity rests with us. A heavy burden... teferifuterafhumanitireswitas5ahefibardin 15,R81,01,A30,81,02,135, ...but one we must bear. For if we don't, who will? batwanwimusbar6forifwidant4woowil R145,81,01,A35,81,01, , m z 1 2 d 3 4 b Z Z M Z d QF d d 67 Z f ww?wAw d R d rs Z 3D jk jk Mission Briefing.Dakota System, $T hours, $D. No time to waste, people, so let's get to it. notimtowastpepl3solatsgattuat Xi wing reports a Kilrathi supply convoy moving into our attack range. siwinrepartakilratisaplicanfoimufinintoaratakrainj We can't pass up a target like this...so Epsilon wing is going to take it out. wecanpasapatargitlaktis4soapsilanwinisgointotaikitawt 7,5, We can't spare any backup, $C. You think you can do this alone? wecansparinibakup3diptic5utinucandutisalon R140,81,01, 7,6, $C, you will lead Knight on this one. You boys think you can pull it off? diptic3uwileedniitantiswan5uboitinkucanpulitaf R145,81,01,135,81,01, No problem, sir. noprablim3sar A5,R130,81,01,135,81,01,150,81,02, There is something you don't yet know, $C. terisamtinudanyetno3diptic R130,81,01,140,81,01, Our spotters have placed a Kilrathi ace, Bakhtosh Redclaw, with the convoy. arspatirsafplaistakilratiaisnamedbaktasredclawitecanfoi R130,81,01,140,81,01, He's a Kilrathi nobleman, and the deadliest shot in the entire Kirathi navy. histededlisatintentirkilratinafi6hisarogan3bathisernteritbitertandards R130,81,01,140,81,01, Here's the scenario for this one. hirtesetapfartiswan R130,81,01,140,81,01, You'll first intercept a Dorkir-class tanker at the jumppoint near Nav 1. Blow her to bits and proceed to Nav 2. At that point, you should sight at least one Kilrathi troop transport. Those transports are your main objective ... and probably the best defended. You are to engage and destroy all Kilrathi transports. No survivors. uartuingaijandistroialkilratitranpart5nosurfifors R130,81,01,A30,81,01,A30,81,01, You watch yourself with Redclaw, but concentrate your fire on the 'sports. uwaturselfwitredclaw5batcansantratyurfirantesports 130,R81,01,140,81,01,A45,81,02,A35, You launch in three minutes. ulansintreminats R135,81,01,130,81,01,135, Dismissed. $ P ' V x Z y Z -Q2 gm Z .Z DKP P 5;t F 01Z 23 Z Z Z 2 Z iZ Z ? Z D Z hi Z Ky Z Z 3 2 2 AFl2 2 2 Ebu P n n Mission debriefing. $T hours, $D. Good landing, $C. How did things go out there? gudlandin3diptic5hawdidtingoawter 1,4, The tanker's been nailed, sir. She went up in a flash. tetankirsbinaild3sar5sewentapinaflas A10,R81,01,240,81,01,235, Good job. How did you fare against the troop carriers? gudjab5hawdidufaragintetrewpcariers R240,81,01,235,81,01, 1,6, The tanker got away, sir. tetankirgatawai3sar R81,01,240,81,01,435, Hmmm....that's not good, $R. How did you fare against the troop carriers? hmmm3tatnatgud3diptic5hawdidufaragintetrupcariers RA30,81,01,250,81,01, 3,17, We took out the first transport without too much problem... witukawtefarstranportwitawtumacprablim R81,01,A45,81,01,235, 5,11, ...the second one was tougher...but we got her too. tesecanwanwastufir3batwigatirtu R230,81,01,230,81,01, 7,9, I knew that you boys could do it. That's damn good work. anutatuboiscooduit5tatdamgudwark RA45,81,01,235,81,01,140,81,02, 7,10, I knew you could do it, $C. That's damn good work. inuucooduit3diptic6tatdamgudwark A10,R81,01,235,81,01,240, 24, But the second transport was too well defended. We never got a clean shot at her. butesecantranportwastuweldefindad5winefargotaclinsatatir R245,81,01,435,81,01,250,81,02, 13, I see. Well, one of two isn't bad, $C. We'll take what we can get. asee5wel3wanuftuisanbad3diptik5wiltaikwatwicanget R245,81,01,235,81,01,A50,81,02, 7,15, You two have done well today. utuafdunweltodai R81,01,135,81,01,230,81,01, 7,16, You did well today, $R. udidweltodai3diptik R81,01,235,81,01,240, 24, Those furballs were on us too quick for a shot at the first transport... tosfurbalswirofirastucwiktoafasatatefartanspart A25,81,01,235,R81,02,435,81,02,240, 5,21, ...but the second Dorkir didn't get away. We nailed her. butesecandorkirdidangetawai5winaltir3batgud R230,81,01,240,81,01, Good. At least we've hindered their plans, if not ruined them entirely. gud3atliswifhindarterplan3ifnatroontementarli R235,81,01,A40,81,01,A30,81,01, 24, ...and the second Dorkir slipped away in the heat of battle. antesecandorkirsliptawaiinteheetafbatil A20,81,01,235,R81,01,435,81,02,440, What? You missed them both? What were you doing, $R? Sleeping at the stick? wat7umistembot5watwirudoin3diptik4slipinbehintetik 510,R81,01,645,81,01,640, We needed to kill at least one of those troop 'sports. You blew it, $C. winiditukilatlistwanaftotruport5ubluit3diptik A40,R81,01,635,81,01,640, 4,25, According to the log, you shot down Bakhtosh Redclaw. My congratulations. acordintotelag3usatownbaktasredclaw5micangratulasuns A45,81,01,235,R81,01,240, 4,26, You also let Bakhtosh Redclaw escape. I was hoping to remove that thorn from our side. ualsoletbaktasredclawescaip5iwasopintoremuftatornframarsid A45,81,01,235,R81,01,240, According to your flight recorder... acordintuurcombatlog RA45,81,01,A35,81,01,420,81,01, 28, You wasted $K of the fuzzballs, $C... uwaitedsefanaftekilratifitirs3dipstic 29, You came back scoreless, $C... ucambakscorlis3diptic 7,32,30, and Knight took down $L. aniitukdansedad 31, and Knight didn't get any kills. aniitidangetanikils 7,32, Knight got wasted this trip. niitgatwaitidisrip A20,R81,02,435,81,01,A50,81,02, 33, $R, stop by my office after your shift. diptic3tapbimafisaftirursift R245,81,01,235,81,01,A50,81,02, Dismissed. 2 5 Z 2 2 Tx2 2 9?x2 -2 PQl2 PQl Hey, $C. How's about a cool drink and a tall tale? helo3maboi5awsabatakulrinkanataltail 245,R81,02,A45,81,01,A35,81,01,A40, Word is, we're pullin' out soon. Hopefully, it's for Kurasawa System. wurdis3wirpulinawtun5opfalitfartekurasasistim RA40,81,01,A35,81,01,A50,81,02, There's some Kilrathi colonies to beat up on when we get there. tersamkilratipusistopawndwinwigeter R81,01,A35,81,01,A50,81,02,220, Also, I heard that one of the Kilrathi Aces is flyin' 'round these parts. also3ihirdatwanuftakilratiaisisisflinaronteespart A45,81,01,A35,R81,01,240,81,01,A50, 5,5, Go ask Paladin ... I think he's tangled with him before. goaskpaladin3itinkistangiltwitimbefar A45,81,01,A35,R81,01,240,81,01,A50, 5,6, Ask around ... someone's got to have heard something about him. askaron3samwansgatuafirdsamtinabotim A5,81,01,A35,R81,01,240,81,01,A50, Take care of yourself, $C. takarafurself3diptik A45,81,01,A35,R81,01,240,81,01,A50, 4 T Z P fg Y 5,1, Ah, $C. Join our party. a3diptik5joinarparti RA45,81,01,A35,81,01,A50,81,02, 5,2, Ah, $C. Join me. We have not had a chance to talk much. a3diptik5joinmi4wiafnatadacansutalkmuc RA45,81,01,A35,81,01,A50,81,02, We have done well to this point. I believe you have played a major part. wiafdunweltutispoin5ibelifuafplaidamajorpart R81,01,A35,81,01,A30, However, should we falter now, I fear that we will be pushed back to our colonies. hawefar3sudwifaltrnaw3ifirtatwiwilbepusbaktuarcalanis RA45,81,01,A35,81,01,A40,81,02, But that is not likely. You, myself, all of us can affect that outcome. butatisnatlikli5u2maself3alufascanafectatawtcum R81,01,A35,81,01,A50,81,02,A25, Think about that when next you fly. It will guide your actions. tinkabotatwinecsufli5itwilgiduractons RA45,81,01,A35,81,01,A50,81,02, K z $q ; D de Jp De De Well now, lad. 'Tis good to see you again. Have a seat and tilt a glass. welnaw3lad5tisgadusiyewagin5hafasitantiltaglas R140,81,01,135,81,01,140,81,01, I hear ol' Shotglass rumblin' on about one o' the Kilrathi aces. ihirolsatglasrumlinonabotwanotakilratiaisis R81,01,A35,81,02,150,81,01, Last I 'eard, laddie, the only ace around these parts was Bakhtosh Redclaw. latahird3ladi4teanliaisarontespartwasbaktasredclaw R145,81,01,A35,81,01,230,81,02, T'was back a few years when I had a tussle with him. iwasbakafewyirswinaadatasalwitim RA45,81,01,A35,81,01,A50,81,02, He's one o' their nobles, so it's said.While most Kilrathi look at humans as animals... hiswanoternabils3soitsed5wilmaskilratilukatumansasanimals R81,01,135,81,01,710,120,81,02, ...he thinks that we're not even that high or mighty. hitintatwirnatefantataiormiti RA45,81,01,A35,81,01,A40,81,02, Anyhow, lad, I was servin' on a cruiser when he led a Jalthi attack on our ship. aniaw2lad3iwaserfinanacrusirwaniledajaltiatakanarsip R81,02,A35,81,01,A35,81,01,A20,81,02, He's easily the deadest aim that Kilrah's got to offer. hisisalitededistaimtatkilrahsgatuafir 55,A20,81,01,R135,81,01,140,81,01, He took out four o' me mates before we knew what hit us. hetukawtforomiwinbefarwinuwatitas R145,81,01,635,81,01,A50,81,02, Keep an eye out for him, lad. He's a tough warrior. kipaniawtforim4lad7hisatufwarior R81,01,A35,81,01,A40,81,02, z H 0 1 d 2 3 p K K 45bd P E ek Z F jq ,0 ,12XY ,Z, U P BC P Z P B Z Mission Briefing.Port Hedland, $T hours, $D. I know you're all excited about tomorrow's TCSO show, but... inouralecsitidabotomorostesesoso3but 6,4, Yeah -- bring on the babes ye3brinontabaibs$40 RA20,81,01,A30,81,01,A35,81,01, That'll be enough, Maniac. tatulbenuf4maneak 645,R81,01,A40,81,02,A35, We've got work to do. Alpha Wing's up first. wevgatwrktudup5alfawagsapfrst RA45,81,01,235,81,01,A50,81,02,135,81,01, You wait for the commander to come to Eta Wing and your mission. Then... 7,7, $C, Knight, you're on escort duty today. dipstic4niit5uronescordutitodai R135,81,01,150,81,02,140,81,01, 7,8, $C, you'll be flying solo today. Escort duty. dipstic3ulbeflinsolotoda4escorduti RA45,81,01,235,81,01,A50,81,02,135,81,01, There's a Drayman coming, carrying vital supplies... tersadraimancomin3cariinfitalsuplas RA45,81,01,235,81,01,A50,81,02,135,81,01, 6,10, And some vital babes ansamcueaypeopularidiots 750,R81,01,A45,81,01,81,030, Bring it home safely. This is your flight plan... You'll head straight for Nav 1 -- the Drayman's jump point. Wait for her there, but be careful... ... we've had reports of heavy enemy activity in the area. The 'sport has orders to make a beeline for the Tiger's Claw. Stay with her. Simple as that. Questions? staiwiter5simulastat6cwastans R150,81,01,135,81,01,130,81,02, Yes, sir. You said there's heavy enemy activity. Any details? yas2sar4usadershafiinamiactifiti6aniditails A20,R81,01,135,81,01,140, The Kilrathi have been moving heavy fighters into this sector, $C. tekilratihafbanmofinhefifatirsintotisector3dipstic R140,81,02,A35,81,01,A40,81,01, I expect you'll be running into Gratha, maybe Jalthi... iecspeculberuninintograta3mabijalti 120,A25,R81,01,A30,81,01,A40, The pilots all seem to be rookies, but there are lots of them. tepilatsalseemtoberukis4buterarlatsaftem 240,81,01,A30,R81,01,135, Anything else?...Good. That's all then. initinels7gud4tatsalten R235,81,01,A50,81,02,135,81,01, Be careful and remember -- I want everyone back for the TCSO show Squadron dismissed. $ 0 g U $eF K 78 K K XcK W K uvK Ds K K U K K BlP K Eo U A OTkK A A .ALA MXckP lyF Ld MNYad MNYa Mission debriefing. $T hours, $D. $7,7,12, That was an impressive display of teamwork, gentlemen. tatwasanimpresafdispaiaftemwark3jintalmin With the supplies on that 'sport we can kick Kilrah tail in this system. witisaplisonatsportwecankikilratailintisector 110,RA35,81,01,A40,81,01, And the TCSO show will go on as scheduled. Good job all around. antiteeseesosowilgoanaskeduld6gudjabalaraond 75,R81,01,A35,81,02,A45, It was dicey there on the way back, sir, but we did the best we could. itwasdisiterontawabak3sar3batwedidtabeswekood R81,01,A35,81,01,A30, Dicey's an understatement, $C, and your best was pretty damn good. disisanunderstaitmin3dipstic4andurbetwaspritidamgud A5,R81,02,135,81,01,150, Word is you took on several Gratha Let's look at the mission report. werdisutookansafingrata6letslookatimisonreport RA35,81,02,A35,81,01,A40, 19,1,10, Another 'sport lost We might as well just surrender...Any excuses? anatersportlast5wimitaswelsurindar4iniecusis 410,R630,81,01,640,81,03,635, No, sir. Gratha jumped us on the way home. We just blew it. no2sar5gratajumdusantawaihom5wijutbluit A10,420,81,01,420,R81,01,A35, We can't afford to 'just blow it', mister Let's see how you did... wecantaforto2jutbloit3mistar6letseeaweludid 610,RA45,81,02, 2,18, No, sir. Gratha jumped us before we ever rendezvoused with the 'sport. no2sar5gratajumpusbaforweefurendavoodwitesport A35,R81,01,435,81,01,A40, This just won't do, people. Let's get the mission report over with... tisjutwondo3peepol5letgitamisonreportofarwit RA35,81,01, 2,19, Tough mission, $C. You brought the 'sport home, but lost Knight. tufmison3dipstic5ubrotesporthom4butlotniht A45,R81,01,A35,81,02,430, He was a solid flyer. He'll be missed. hewasasolitflir8hilbemist A45,81,03,A35,R81,02,A35,81,03,A40, We thought we were home free, sir. Then some Gratha jumped us... wetotwewarhomfree3sar5tentreegratajumptus A45,81,01,435,R81,01,A40, They came out of nowhere. Knight and I just couldn't handle them... teycamawtofnowar6nihtandijutcoodantandultem RA35,81,01,A30,81,02, Get a handle on yourself, $C. Knight knew the risks... getahandalonyerself2dipstic5nihtnutarisks 630,R81,01,A35,81,01,A40, And we needed those supplies. You did your job. anwenedidosuplis6udidyerjab RA45,81,01,A35,81,01,A50,81,02, Let's go over the mission report. letgofertamisonrepart RA35,81,01,A45,81,01,A30,81,02, 20, You took out $K, $C... utukawtsefan4diptik 21, No kills this time, $C. Maybe some Squadron in the rec room would help. nokiltitim3diptik5mabisamscwadraninterecrumwudhalp 22, Knight took out $L. nitukawtsefan 23, Knight...no kills. nit3nokils 7,24,25, Fine work. fanwirk 7,25,7,25, Just one more thing, $C, in the future, take better care of your wingman. jaswanmortin3diptik5intefutar3takbetarkarafurwinman 26, And I want to see you in my office later, $C. aniwantuseuinmaiafislatir3diptik Dismissed. dasmast V z Fz 9y KL , , Welcome back, $C. Heard about the TCSO show? welcamak3dipstic5herdaboteteeseesowsow 245,R81,02,A45,81,01,A40,81,01,A50, I hear the Bob Hope holo's a riot. I love ol' Ski-nose... ihirtebabhopholosaraot4ilofolskinos$44 RA40,81,01,A45,81,02,A35,81,02, Retired almost five centuries ago, but you can't keep a good comic down. retartalmosfifsintureesago3butucantkeepagudcamicdan RA45,81,01,A35,81,01,A50,81,02, But seriously, I hear the show may not make it. Too many kitties nearby. butsiriasli4ihirtasomanotmaikit5tumanikitisnirbi A45,81,01,A35,R81,01,240,81,01,A50, Young punks mostly, but in Grathas - top-of-the-line bad news. yanpunsmotli3butingratas4tapatalanbatnus 215,R81,01,A35,81,01,A40,81,02, The furballs must think their kittens're better than our vets. tafarbalsmastinterkitinsarbetartanarfets RA40,81,01,A35,81,01,A50,81,02, And they might be right, if you're talking about a kitten in a Gratha. anteymitberit3efurtalkinabotakitininagrata RA40,81,01,A45,81,01,A40,81,02, Even an amateur's dangerous in one of them... efananamaturdanjirusinwanaftem RA35,81,02,A40,81,01,A35,81,01, 7 J v 2 2 S2 wx2 2 7 AB7 2 ?q2 ?q 6,6, C'mere, mate. Maniac's teachin' me 'ow to fly. Can you believe it? camer2dipstic5manicticinmitufli5canubilifit A20,81,01,225,R130,81,01,A35,81,01, Someone needs to -- you're dangerous, and not just to the Kilrathi. samwanbetar5urtanjiras3anotustotekilrati R230,81,01,225,81,01, I'm dangerous? I'm dangerous amdanjiras4amdanjiras 535,81,01,645,R81,01,135,81,01,A50, This from the guy who goes to afterburners the instant 'e smells a target tisframtagiwugosaftirbernerstaintantismelsatarget RA45,81,01,A35,81,01,A50,81,02, Well, at least I go after 'em. Some of you old guys don't always do that. welatlistagoafturem5samofuawlgisdonalwaisdotat R220,81,01,A25,81,01,A20,81,01, I 'ate to admit it, mate, but you're right about some of the old guys.' ihaitoadmitit4buturitabotsamafta2oldgis R140,81,01,135,81,01,A30,81,01, Knight, Paladin, some others, they must be cat lovers...or pacifists. niht3paladin4samaters4teymutbecatlafers5orpasifiss RA45,81,01,A35,81,01,A40,81,01, But don't lump me with that lot, mate. batdonlapmeanwattatlat2mat RA35,81,01,235,81,01,A40,81,01, The more Kilrah blood I smell, the nastier I get. temorkalrabladismal3tenastearigat RA45,81,02,A50,81,01,A30,81,01, 2 ? k 7 2 V2 2 .V7 pv2 K7 kl2 9d7 7 $;7 $; Hey, $C. I feel like griping about wingmen. Care to join in? ai2dipstic4ifilikripinabotwinmin4cartujanin 110,R81,01,120,81,01,115, Take Knight, for example. He flies like an old lady. No vision... taknit2forisamal3hiflislikanaldladi5nofison 215,R81,01,A25,81,01,A30, ...and he couldn't find a target if his wingman's life depended on it. anicudantfinatargitifiswinmanlifdepidadonit R120,81,01,110,81,01,130,81,02, 1,4, Which it usually does... wijisusalidos R135,81,01,130,81,01,A40,81,01, Yeah. And Angel...Always studying, planning. Just fly, I say. ya5ananjil3alwasudin2planin5jastfli2asi 210,R81,01,A25,81,01,120, 6,7, Anybody on the the Claw you don't mind flyin' with, squirt? $5anibadintaclaudanminflinwit3swirt 130,R81,01,135,81,01,150, First off, let's watch the squirt cracks. And second... firsaf2letwateswirtcracs5ansecand R120,81,01,125,81,01,A20,81,01, 'Course there're a couple of pilots I don't mind flying with. cortersacapalofpilatsidanminflinwit RA15,81,01,125,81,01,A30,81,01, You're not too bad, Hunter -- almost as good as me. And there's Iceman... yernatubat2antar3almotasgudasmi5anersisman R220,81,01,A25,81,01,130,81,03, Ice is scary, man. I mean, I'm in this for the flying... asiscari4man6imin2amintisfoteflin 410,R120,81,01,A25,81,01,111, He's in it for the killing, I think. hisinitfortakilin3itin R410,81,01,A25,81,01,A20,81,01, S E W 0 1 d 2 3 U V P W X j u Z v Z A Z ?m ,$,cdwef d Z ,L Z hi Z As d Z .JU KL Z 1 Z GHWa Mission Briefing.Port Hedland, $T hours, $D. Five minutes into the briefing... ...next, Xi Wing. neks3zewag 7,4, That'll be $C and Knight. tatalbidipsticannite R130,A3,81,01,A40,81,01,A35,81,01, 7,5, You'll go solo this time, $C. ulgosolotisime3dipstic R140,81,01, Yes, sir. yas2sar R145,81,01,135,81,01, Today's mission is a four-point patrol route. todasmisanisatreepantpatralroot RA30,81,01,135,81,01,150,81,02, Computer, display Xi. camputr3dasplaze R130,81,01, You'll pass through each Nav Point, checking for enemy activity. There's a field of what looks like asteroids around Nav 2... ...and another at Nav 4. Now, remember, you ran into heavy fighters last time... naw2remambir3uranintohafifatirslastim R135,81,01,130,81,02, and you can expect more of the same this time out... anucanacspactmoraftasamtisamawt R81,01,135,81,01,A30,81,01, In fact, intelligence reports that enemy traffic is heavier than ever. infac3intalaginsrapartatenamitraficishefirtanefar A35,R230,81,01,130, And our people on McLaren think they've spotted a new capital ship class. andarpeepalanmiclarintinefspatidanucapitalsipclas RA30,81,01,120,81,01,235,81,01, We're calling it 'Fralthi.' If you see it, observe as closely as you can. wircalinit2fralti6ifuseit3absurfasclowsliasucan R130,81,01,230,81,01,A30,81,01, Any questions? anicwestans Sir, if we spot this 'Fralthi,' should we engage? sar3ifwispatisfralti4soodweingaij 120,81,01,720,R81,01,130, There's no need for heroics, $C. Just come back to tell us about it. ternonidfarherocs3dipstic5juscambakantelasabatit R130,81,01,140,81,01, Anything else? anitinals R235,81,01,A30,81,01,135, All right, then. I'll expect a full report when you get back. alrit2tanp5ilekspekafalreportwanyugatbak Dismissed. $ ' h i Z j p Z BZ XP S Z ijP 5cP yZ P P F Z ;w P P GNF F ?yP 2P RS F b F F Y ,MZ NSqZ Z F P a2 2 Mission debriefing. $T hours, $D. Welcome back, $C. What's the word on the debris at Navs 2 and 4? 4,3, Nav 4 was nothing -- just an asteroid field, easily bypassed. naforwasnatin3jasanasoidfil3isalibipast R81,01,240,81,01,235, 4,4,2,5, Sorry, sir, but we never made it to Nav 4. sari2sar3batwinefarmaiditonafor RA30,81,01,250,81,01, 1,5, Nav 2 was a Kilrathi mine field -- tricky flying getting through there. naftoowasakilratimanfild2trikiflingetintruter R81,01,A45,81,01,A35, 1,6, Sorry, but we were waylayed before we got to Nav 2, sir. sari3batwiwarwailaidbefarwigatonaftoo3sar RA30,81,02,250,81,01, Okay, now let's cut to the chase -- any sign of the Fralthi?. oka3nawletcatotacais4anisinaftefalti RA45,81,01,A35,81,01,A40,81,02, 3,8, Sorry, sir, but there were no Kilrathi capital ships to be found. sari2sar3baterwernokilraticapitalsipstobefand R81,01,A30,81,01,A40, 3,21, Yes, sir, and she's something to see. A large, heavily armed cruiser. yas2sar3ansisamtintosi5alarg3hefiliarmcrusir RA45,81,01,A35,81,01,A50,81,02, And she has launch capabilities. She's like a smaller, faster Claw, sir. ansiaslancapabilitis6sislikasmalir3fasirclaw4sar RA35,81,01,A30,81,01, 3,14, Or, I guess I should say, she WAS something to see... ar2igasisudsai3siwasamtintosi RA35,81,01,A45,81,01,A30,81,01, And she HAD launch capability ... We got her, sir We got her ansihadlancapabiliti3sar2wigatir4wigatir R81,01,A25,81,01,A30,81,01, Well, gentleman, I am impressed. That's one for the record books. wel3gintalmin4iamimprest6tatwanfortarecardbuks A35,81,01,135,R81,01,A35,81,01,A40, The brass will be very happy to hear this. Congratulations tebraswalbefarehapetohertas5cangratulatans RA30,81,01,A40,81,01, Save the rest for Tactical, $C. Anything to add, Khumalo? saftarestartatical3dipstic6anitinalstoad3kumalo A45,81,03,235,R81,05,435,81,04,440, 3,17, $C's right, sir. The Fralthi is one tough ship... dipsticsrat3sar5tafraltiiswantafsip RA45,81,01,A35,81,01,A50,81,02, ...far more impressive than the Ralari. I'd add just one thing... farmarimprasiftanteralari5idadjaswantin RA45,81,01,A35, The Kilrathi were all over us as soon as we showed up... tekilratiweralofarasasunaswisowdup R145,81,01,135,81,01,A50,81,02, Fighter cover was high, like they couldn't afford to lose the Fralthi. fatarcafirwashi3lakteycudantafardolostafralti RA45,81,01,135,81,01,A50,81,02, I'm betting they only have a few of them, maybe just the one... imbetinteyonliafafewaftem3mabijestawan R145,81,01,A35,81,01,A50,81,02, Possible. Let the Intelligence boys figure that out. Full report by 0900. pasibal4leteintelijansboisfigartatawt5fulrapartbiohninandrid R135,81,01,A35,81,01,A40,81,02, 3,22,3,22, Well, maybe we'll spot her some other time...if she really exists. wel3mabiwilspatirsamaturtam4ifsiriliecsists A5,R81,01,A35,81,01,A30, Anything else before we turn to the mission report? No? Good... anitinalsbeforwitarntotemisanripart2m7no3gud A45,81,01,A35,R81,02,250,81,01,135, A scan of your recorder shows... ascanafurcamputarsrecardsos RA45,81,01,A35,81,01,415,81,01, 25, You trashed $K Kilrathi, $C... utrastsefankilratifitirs3dipstic 26, I saw no kills for you, $C... isawnokilsforu3diptik 7,29,27, and Knight took care of $L himself. anitukareafsefanimself 28, and Knight came up empty. aniitcamapimpti 7,29, And the damn cats took out Knight. antedamcatukawtnit R635,81,01,435,81,01,A40,81,01, 30, Oh, and $C - my office, after you've cleaned up. o2andipstic4miafis3aftirufcleentup 81,01,RA45,81,01,A35,81,01,A30,81,01, Dismissed. dasmast 2 2 M N 2 I2 ij2 ;2 2 -X2 2 Ak2 Ak $C How's it goin'? dipstik5howsatgoan 245,R81,02,A45,81,01,A35,81,01,A50, Heard you had to take out some Gratha tryin' to bring that Drayman in. herduadotakawtsumgratatobrintedramanin RA45,81,01,A35,81,01,A50,81,02, Glad to see you made it back in one piece. Those babies are tough... gladusiumaditbakinwanpis5tosbabisartuf R81,01,A35,81,01,A50,81,02,A20, ...but I hear the Jalthi's even tougher. butihirtejaltisefintafir A45,81,01,A35,R81,01,240,81,01,A50, One of those six-shooters on your tail, you can kiss it goodbye. wanaftossaksutrsanyurtal3yukankasatgudbi A45,81,01,A35,R81,01,240,81,01,A30, But I'll bet if you get low an' behind a Jalthi, you'd toast it. batalbatafyugatloanbehinajaltep3yudtostat A45,81,01,A35,R81,01,240,81,01,A50, She's got no rear visibility, and big ol' bullseye exhausts. sesgatnorervasabalatep3anbagolbulsieksasts A45,81,01,A35,R81,01,240,81,01,A50, Bad design, no matter how many guns she's got up front. badesinomatirawmanigunsyagatapfrant A45,81,01,A35,R81,01,240,81,01,A50, Just jam a missile up those rear pipes and -- BOOM No more kitty. jusjamatorpaptosrirpipsan2booom5nomorkiti A45,81,01,A35,R81,01,240,81,01,A50, K K K L z K ,K FGK MK ghK KpK K Hey, $C. Have a seat. hai3diptic5hafasit RA45,81,01,235,81,01,A50,81,02, I've heard some talk lately that burns me up. ifharsamtalklatlitatbarnmiap 210,81,01,630,R81,01,A35,81,01,235, Someone's saying I'm unsafe to fly with...and that I'm a cat-lover. samwanssaagimansaiftofliwit3antatimacatlavr 235,81,01,635,R81,01,A50, Well, I won't stand for that kind of slander. It's not true. wel3iwanstanfartatkindafslandir5itnatru RA45,81,01,235,81,01,A50,81,02, I may not be as high-flying as Hunter, but I get the job done...in one piece. imainatbeashiflinashantir3batigitejabdan4inwanpis 220,R81,01,235,81,01,A35, But hey, you're not the guy to complain to...after all, we've flown together now. batey3urnategitucamplintu3aftiral3wiflowntogetarnaw R245,81,01,A35,81,01,230,81,01, You know you can count on me. It's just a matter of trust. unoucancawntanmi5itjastamatiraftrust R245,81,01,A35,81,01,A50,81,02, Thanks for the shoulder, $C. tanksfortesoldr3diptik RA45,81,01,435,81,01,250,81,02, K J K K fK K QK K cK K 34qK K 7,1, Join me, $C. Knight is poor company and I feel the need to talk... jonmi3dipstic5niitisparcampiniandifiltenidtotalk R145,81,01,235,81,01,A50,81,02, 7,2, Welcome, $C. Join me won't you? I am in need of company... welcam3disptic5joinmiwontu5iamineedafcampani R145,81,01,235,81,01,A50,81,02, I have been studying the history and progress of the war... ihafbinstudintehisorianpragresaftewar R245,81,01,A35,81,01,430,81,03, ...and I fear things do not go well for us. anifirtinstonatgowelfaras R81,01,A35,81,01,A40,81,02, We are in grave danger, and must be ever diligent, ever alert... wearingrafdanjir4anmusbeeferdilijint3efaralart R230,81,01,A35,81,01,A50,81,02, We must fight as if there were no tomorrow, for in truth... wimusfitasifterwernotomarofor3intrut R81,01,A35,81,01,A40,81,02, ...that is the case...every day, the Kilrathi bring up more troops. tatistecas4efridai3tekilratibrinupmortrups RA35,81,01,A25,81,02,A40,81,02, They penetrate deeper into human space each time we fly. teypinitratdeepirintohumanspaiseectimwifli RA45,81,01,A35,81,01,A50,81,02, The very future of humanity rests with us. A heavy burden... teferifuterafhumanitireswitas5ahefibardin 245,81,01,R81,01,A50,81,02,A35, ...but one we must bear. For if we don't, who will? batwanwimusbar6forifwidant4woowil 430,R81,01,235,81,01,A35, D P 0 1 d 2 3 v Z w x Z d Z Z X P F P P F Uzd w w? wABwwwZww P X Z xy Z 0 JKVW JKVW Mission Briefing.Port Hedland, $T hours, $D. We've got a Code Red out there, people... wevgatacodredowttar3pepl Every Confederation ship in the system is under attack. evrecanfadaratansapantesastamasandratak The rest of our fighters have been deployed...you Blue Devils will defend the Claw. terasafowrfitrshavbandeplodp5yubludavlswaldefantecla R130,A3,81,01,A40,81,01,A35,81,01, 7,5, Since Knight's no longer with us, you'll fly Sigma wing alone, $C. sinsnatnalangirwitas3tatputuanurown3dipstic R130,81,01,135,81,01, 7,6, $C and Knight...you two will form the final wing. $C will lead. diptsicaniit3utuwilfartefinalwin5dipsticwileed R145,81,01,135,81,01, Listen close, boys, there's a complication... lissinclosbois3tarsacamplacatan RA30,81,01,135,81,01,140,81,01, One of our destroyers has sighted another Fralthi-class cruiser... wanafowrdestrayrshassitadanatrfralteclascruzr R130,81,01, You'll need to move to assist the Exeter against several fighters... yulnedtumovtuasastteaxatraganssavralfitrs R81,01,135,81,01,A40,81,01,230, ...before you can continue on to attack this new Fralthi. beforyucancantanuantuataktasnufralte RA30,81,01,140,81,01,130,81,01, Computer, display Sigma. camputr3dasplasagma First, you'll need to assist in the defense of the Tiger's Claw. We'll have two more Scims in space before you... ...but there are four Jalthi closing with the Claw, so it won't be easy. When you've cleaned up the Jalthi, move on to Nav 1... ...where you'll help defend one of our Exeters against a wing of Gratha. If you're still in good enough shape after turning the Gratha away... ...I want you to fly on to Nav 2, the last known fix on this Fralthi. Take a crack at her, if you can, but try not to get yourself killed. That Fralthi has to be where all these fighters are coming from. tatfraltiastubeweraltesfitarsarcaminfram R140,81,02,230,81,01,A30,81,01, If we can take her out, we won't have so many furballs to worry about. ifwecantaikirawt3wewantafsomanifaribalstuwariabat R81,01,135, Very well. Good luck, boys. variwal4goodlak3bois R235,81,01,A30,81,01,135, Dismissed. $ d ' U V F W 2 ,2t F Y F P R P ,JOPQF RSF P 67 P 1 F GH F P XP YwF F F 9 F Y Mission debriefing. $T hours, $D. Glad you're back, $C. Let's have your report. 2,5, The Exeter's safe and sound, sir. tecsitarsafinsan3sar R230,81,01,235,81,01, Well done. She's too valuable a piece of hardware to lose. waldan5sistufalwabalapisafardwartulus 25,R81,01,240,81,01,235, 7, 2,7, We've lost the Exeter, sir. Those damn Kilrathi had it in for us. wiflastecsitar3sar5tosdamkilratiaditinfaras R230,81,03,420,81,02,240,81,01, That's not good news, $R. Go ahead. tatnatgudnus3dipstic5goahed 610,R81,01,245,81,01,235, 4,12, It was quite a scrap, sir, but the Fralthi is history itwascwitasrap3sar4batefraltisistari RA30,81,02,250,81,01, 7,9, Congratulations to both of you. congatulasansubotafyew R215,A1,115,81,01,A40,81,02, 7,10,7,11, Congratulations, $C. Of course, Knight will be mentioned in the log for his sacrifice. canratulatans3dipstic5afcars3niitwilbemintintelagforisacrafis 210,R81,01,230,81,01,A25, 7,11, Congratulations, $C. I guarantee that you'll be mentioned in the log. cangatulasans3dipstic5igarantiatulbemintandintelog R245,81,01,235,81,01,A50,81,02, 17, We got in over our heads this time, sir. wigatinafararhedistim3sar R235,81,01,445,81,01,A30,81,01, Those furballs were too vicious...and the Fralthi got away. tosfarbalswirtufisas4antefraltigatawai R81,01,A25,81,01,A30,81,01, That's not the report I like to hear, mister. We had to nail that ship. tatnateripartiliktoir3misir5wiadtonailatsip 230,81,01,640,R81,01,235,81,01,A40, I'm afraid we're going to have the Kilrathi laughing at us. amafradwirgointoaftekilratilafinatas R630,81,01,A40,81,01, I'll read the rest of your report later...in my office. alreederetafurepartlatir4inmafis A15,R81,01,235,81,01,240, According to your flight recorder... acordintourflitcampewtar R245,81,01,A35,81,01, 19, You did get $K of the fuzzballs, $C... udidgetsefanfasbals3dipstic 20, You came up empty, $C... ucamaptimpi3dipstic 7,23,21, and Knight shot down $L. anitsatawnblarg 22, and Knight came away with no kills. anitcamawaiwitnakils 7,23, And Knight got trashed out there. anitgatrasawter 220,R81,01,435,81,01,A50,81,02, 24, $R, I need to see you in my office, now. dipstic3initosiuanmiafis3naw RA45,81,01,A35,81,01,A50,81,02, Dismissed. 2 ; a 2 2 Z2 2 4u2 2 ?Zp2 ?Zp Hello, my boy. How's about a cool drink and a tall tale? halo3maboi5hawsabotaculrinkanataltail 245,R81,02,A45,81,01,A35,81,01,A50, Word is, we're pulling out soon ... maybe for the Rostov System. wordaswerpalagowtsunp3mabeforterastavsastam RA45,81,01,A35,81,01,A50,81,02, Remind me to tell you about a little place I know, when we get there. reminitotaluabotalitalplaisino3wanwigetar R81,01,A35,81,01,A30,81,02, I heard that one of the Kilrathi aces is flying around these parts. ihirdatwanaftekilratiasisisflinarontispart A40,81,01,A35,R81,01,240,81,01,A50, 5,5, Go and ask Paladin...I think he's tangled with him before. goanaspaladin4itinisangiltwitimbefar R81,01,235,81,01,A40, 5,6, Ask around...someone's got to have heard something about him. askaron3samwansgatahafirdsamtinabotim A45,81,01,A35,R81,01,240,81,01,A50, Take care of yourself, $C. takarafurself3dipstic R81,01,230,81,01,A40,81,01,430, 6 V H hi Jx 5,1, Ah, $C. Join our party. ah3dipstic5joinarparti RA35,81,01,235,81,01,135,81,02, 5,2, Ah, $C. Join me. We have not had a chance to talk much. ah3dipstic5joinmi5wiafnatadacansutalkmuc RA35,81,01,235,81,01,240,81,02, There is little time remaining to turn this war in our favor... terislitaltimrimanintotarniswaranowrfavor R240,81,01,A35,81,02,A50,81,01, Should we fail now, I fear that we will be pushed back to the Homeworlds. sudwifalnaw3afiratwiwilbepusbaktotehomwrlds R81,01,A35,81,01,430,81,01,230, But there is always hope. You, myself, all of us can affect that outcome. baterisalwisawp5u3masef3alafascanefecatawtcam A20,81,01,210,A10,120,R81,01,A35, Think about that when next you fly. It will guide your actions. tinabotatwinectufli5itwilgidyaractons RA40,81,01,A35,81,01,A30,81,02, F K z F F $qP F ;Z DF deF JpP Z DeZ De Well now, lad. 'Tis good to see you again. Have a seat and tilt a glass. welnaw3lad5tisgadusiyewagin5hafasitantiltaglas R140,81,01,135,81,01,140,81,01, I hear ol' Shotglass rumblin' on about one o' the Kilrathi aces. ihirolsatglasrumlinonabotwanotakilratiaisis R81,01,A35,81,02,150,81,01, Last I 'eard, laddie, the only ace around these parts was Bakhtosh Redclaw. latahird3ladi4teanliaisarontespartwasbaktasredclaw R145,81,01,A35,81,01,230,81,02, T'was back a few years when I had a tussle with him. iwasbakafewyirswinaadatasalwitim RA45,81,01,A35,81,01,A50,81,02, He's one o' their nobles, so it's said.While most Kilrathi look at humans as animals... hiswanoternabils3soitsed5wilmaskilratilukatumansasanimals R81,01,135,81,01,710,120,81,02, ...he thinks that we're not even that high or mighty. hitintatwirnatefantataiormiti RA45,81,01,A35,81,01,A40,81,02, Anyhow, lad, I was servin' on a cruiser when he led a Jalthi attack on our ship. aniaw2lad3iwaserfinanacrusirwaniledajaltiatakanarsip R81,02,A35,81,01,A35,81,01,A20,81,02, He's easily the deadest aim that Kilrah's got to offer. hisisalitededistaimtatkilrahsgatuafir 55,A20,81,01,R135,81,01,140,81,01, He took out four o' me mates before we knew what hit us. hetukawtforomiwinbefarwinuwatitas R145,81,01,635,81,01,A50,81,02, Keep an eye out for him, lad. He's a tough warrior. kipaniawtforim4lad7hisatufwarior R81,01,A35,81,01,A40,81,02, X 2 x 3 4 F 5 6 d P P Av Z wx Z 0 P PQ P P Z Hb Z QRx STrs P tud 3,45,,,cd,ef, Z F P F 6 F KL F 8d 9Nd 9N Mission Briefing.Kurasawa System, $T hours, $D. All right, boys and girls. Let's get to work. alrit2bosadgrlsp4latsgotuwrk First, I want to congratulate you all for your efforts at Dakota. frst2iwantycangratulatyualforyurafortsatdakota Our successes there were crucial to recent developments in the war effort. arsaksasasterwerkrusalturesendevalapmensantewarafort The Kilrathi advance has been halted... tekalrateadvanshasbanhaltad RA50,81,02,235,81,01,A50,81,02, ...and now the Confederation is on the offensive. adnowtecanfadaratanasanteafansav RA50,81,02,135,81,01,A50,81,02, Now we're moving on the Kilrathi bases in the Kurasawa System. nowermuvagantekalratebasasantekurasawasastam RA50,81,02,235,81,01,A50,81,02, These bases are vital to Kilrathi command and communication in the sector. tesbasasarvitltukalratekamanadkamunakatanantesaktor RA50,81,02,135,81,01,A50,81,02, The Empire is currently trying to ferry troops and supplies to these bases... teampirascaranletriagtufaretrupsadsaplistutesbasas RA50,81,02,235,81,01,A50,81,02, ...in a frantic attempt to defend them. anafrantakatamttudefantam RA50,81,02,135,81,01,A50,81,02, I'm sending my best pilots,in my best fighters,to head off these supplies. imssandagmibaspilats2anmibasfitrs3tuhadaftessaplis The commander assigns several wings,led by Iceman, Hunter, and other aces. Your assignment comes last... Theta is especially vital, so I'm sending you, $C, with Bossman as your wing. tataasaspaslevitlp3soimsadagyudipstikwatbasmanasyurwag Computer, display Theta Wing... kamputrp3displatatawag We've detected several Kilrathi fighters circling two nearby jump points. One Dorkir-class transport has already jumped in here, at Nav 1a. RA35,81,01,140,81,01, You'll intercept and destroy it, then move on to Nav 2... ...where another squadron of Kilrathi fighters awaits an incoming 'sport. When you've taken care of any 'sports that appear at Nav 2... ...return to the Tiger's Claw via Nav 1b,in case there are any late arrivals. Questions? kwestans Yes, Colonel.Do we have any intelligence regardingthe contents of the 'sports? yas2karnalp5duwehavaneantalajansregardagtesportskantans RA35,81,01,A40,81,01, Nothing definite, Major... natagdafanat2majr ...but that first Dorkir is especially well guarded. battatfrstdorkerasaspaslewalgardad RA5,81,01,A10,81,01, It must be something -- or someone -- the hairballs don't want to lose. atmasbesamtagp3orsamwanp3teharbalsdonwantulus RA35,81,01,A40,81,01, If that's all the questions,then let's get into space. aftatsaltekwastansp3tanlatsgatantuspas Squadron dismissed. skwadrandasmasd $ Z P u Z v Z .KP kqZ P ?Ey Z 3 P 4f P F CJ P F ,-P F ?DXi jo2 7 d d Mission debriefing. $T hours, $D Welcome back, $R. Let's have your report. welcumback3shepdip5letshavyoorreport 1,3, Yes sir. We weren't able to take out the Dokrir at Nav 1a. yessahr5wewernotabeltotakowttargetalpha RA45,81,01,A35,81,01,A50,81,02, 1,4, Yes sir. We nailed the Dorkir at Nav 1a. targetalphawasdestroyed3sahr RA35,81,01,A40,81,01,A50,81,02, 3,5, We were unable to bag any transports at Nav 2. wewirunabletobaganytransportsattargitzonbeta R81,01,A40,81,01,A30, 3,6, We got another 'sport at Nav 2. wetookouthesportattargetzonbeta R81,01,A40,81,01,A30, 5,7, We took out one more at Nav 1b, on the way back in. wedidnttakeouttargitdelta3sahr RA35,81,01,430,81,01,A50,81,02, We've determined that the first Dorkir was a command staff ship, $C... wevdetarmandtattefrsdorkerwasacamanstafsap3dipstik 1,9, Missing that one will set us back somewhat. isee5misintatwanwillsetusbaksumwhat RA45,81,01,A35,81,01,A50,81,02, 1,10, Blasting that one should cripple their chain of command. Good job. blastinthatwansudcripelthirchanafcumand5gudjob R81,01,A45,81,01,A35,81,01,A50, 2,12, Unfortunately, Bossman isn't coming back, Colonel. unfortunatle4bahsmanisntcuminbak3kernel A20,R81,02,440,81,03,430,81,02, Bossman was a real pro. He'll be missed. bahsmanwasarelpro5helbemised A30,R81,02,A35,81,03,430,81,02, I've read the flight log of your engagments, $R. iveredtheflitlahgafyooringaygmints3shepdip RA45,81,01,A35,81,01,425,81,02, 14, You took out $K of the fuzzballs, $C... utookowtsumfusbahls3dipstik 15, The log shows you came up empty, $C... thelahgshowsucamupemte3dipstik 16, and Bossman got $L. andbahsmangotsum 17, and Bossman struck out. andbahsmanstrukowt I'll go over your report in detail later. ilgooveryoorreportindetallayter 110,R81,01,135,81,01,A50,81,02, 19, You did well out there, $C. Stop by my office after you've finished your paperwork. udidwelowtthir3dipstik5stopbymyahfisafteruvfinisedyoorpayperwerk RA40,81,01,A35,81,01,A50,81,02, That's all. Dismissed. thatsahl5dismised Z F C D F SP ijK 8P XYP XY $C, how's it going? dipstik3howsitgoin 230,R81,01,A35,81,01,A40, So here we are, in Kurasawa. Kilrathi call it Warach Tha, they say. soherwear3ankurasawap5kalratecalatwaraktap2tasa RA45,81,01,A35,81,01,230,81,01, Empire's s'posed to have several bases on an' 'round the fourth planet... ampirsposdtuhavsavralbasasananrowntesekanplanat R81,01,A35,81,01,A40, ...so I guess you boys'll be seein' some serious action soon. soigasyuboslbeseansamsereasaktansun RA45,81,01,A35,81,01,230,81,02, Still, we're not the first Terran ship here... stal2wernattefrstaransapher RA45,81,01,A35,81,01,A50,81,02, I heard the Kilrathi in system are already half beat. Ihardtekalrateansastamaralradehafbet R81,01,235,81,01,A25,81,02,230,81,01, U K K LK BCRd BCRd Allo, $C. You have a moment, no? allo3dipstik5uhaveamomint3no A4,R81,02,A35,81,01,A40,81,02, The Colonel has directed our crew chiefs to prepare our Rapiers for battle. thekernelhasdirektidarcroocheefstoprepararraypeursforbatol R130,81,01,A35,81,01,A50,81,02, I had hoped we would have flown them more before now. C'est la vie. ihadhopedwewudhavflonthemmorebefarnow5saylavee 425,R81,02,A45,81,01,A35,81,01,A50, Should you get the chance, let me know how they fly. It is tres important. shoodugetthechans3letmeknowhowthefli5itistreyimportant R135,81,01,135,81,01,A50,81,02, Au revoir, $C. ahrevwahr3dipstik RA45,81,01,A35,81,03,A40,81,02, P 2 F R X P FsF Z RkZ Z $C, am I glad to see you. dipstik3amigladtoseeu RA25,81,01,A15,81,01,A30,81,01, 4,2, I'm going insane listening to Angel talk about fuel-to-acceleration ratios. imgoaginsanlasnantoangltakabotfultoaksalaratanratios RA15,81,01,235,81,01,A20,81,01, 4,3, I'm about to go insane listening to Shotglass talk about the old days. imabottugoinsanlasnantosotglastakabotteoldas RA25,81,01,135,81,01,A10,81,02, Heard that we're about to raid some fuzzball bases. That'd be great hrdtatwerabottoradsamfazbalbases5tatdbegrat$10m RA25,81,01,A30,81,01,A20,81,01, I haven't shot at anything in a week... ihavntshatatanetaganawek RA30,81,01,A15,81,01,A20,81,02, ...and I'm starting to get restless. animstartagtogatraslas RA30,81,01,A15,81,01,A20,81,02, , 5 3 4 Z 5 6 v K w x P 9s U tu Z My K K Fz Z Z 1C F cd 6 ,78 ,O Z PQ 0r st Mission Briefing.Kurasawa System, $T hours, $D. O.K. Boys and girls, we've been lucky. okbusadgrls3wevebinlukee Less than 4 hours ago, we received a Code Blue transmission... lesthanforhowrsago3werecevedacodtheetransmishun It seems our boys captured a Ralari-class destroyer in the Port Hedland System. atsemsarboskapjurdaralareclasdestroaranteporthadlansastam Sector Command wants to use this ship in our seige here at Kurasawa. saktorcamanwanstuyustassapanarsejheratkurasawa RA45,81,01,235,81,01,A50,81,02,135,81,01, I've given my assurances that we'll bring her in intact. ivegivinmyasooransesthatwellbrinherinintakt R135,81,01,A50,81,02,240,81,01, I'm sending a wing to rendezvous with the Ralari and escort it to the Claw. imsendinawingtorandayvooswiththeralareandeskortittothecla R245,81,01,135,81,01,A50,81,02, 2,8, Bossman and $C, This one's yours. $C will fly lead. bahsmanandipstik3thiswonsyoors5dipstikwillflyleed A10,110,R81,01,145,81,01,A30, 2,9, $C, you'll fly this one alone. dipstik3yoolgoinalown R145,81,01,135,81,01, Understood, Colonel. understood3kernel R135,81,01,135,81,01,A30,81,01, Here's the scenario... hersthesanareo Computer, display Omicron. cumputer3displaahmikron R130,81,01, The Ralari entered the system at the jumppoint near Nav 1. theralarientirdthesistimatthejumpointnernavwon There's an asteroid belt along the way.Keep your eyes peeled for trouble. theresanastiroidbeltalongtheway5keepyoorispeeledfortrubel Once you've arrived at the rendezvous point,you'll escort the destroyer back here. onsuvarivedattherahndayvoopoint3yuleskortthedestroyerbakhir One other note.Our sensors show a Kilrathi force approaching at high speed. wonuthernot5ourskowtsreportakilrathiforsaprocheenathiworp They must have been sent to prevent us from getting the Ralari. Expect a tough fight. theymusthavebinsinttoprevintusfromgetintheralari5eckspectatufffit That's all, gentlemen. thatsal3gentelmin Dismissed. dismised $ P , v P 3U 45TsP P 0F P fmP , U K g K 4 NOao F A A $GbA chA P F .3qd d Mission debriefing. $T hours, $D. 1,6, The captured Ralari has pulled into formation with the Claw. Good job, $C tekapjurdralarehaspaldnantuformatanwatteclap2gudjab2dipstik 2,4, Same for you, Major Chen. You both are a credit to the Confederation. samrforu3majurchin5uarbothacredittothecunfedarashun The credit belongs to $C, sir. thecreditbelangstodipstik3sahr 145,R81,01,A35, 2,5, I can't take all the credit, sir. Bossman played a major role. icanttakeallthecredit3sahr5bahsmanplayedamajurrol 225,R81,01,A45, 2,6, Too bad he didn't make it back. toobadhedidntmakitbak A40,81,02,R435,81,03,A40,81,02, 1,12, Explain yourself, $R. Why did you lose the Ralari? ecksplanyoorself4shepdip5whididuloostheralari A5,R81,01,635,81,01,640, We couldn't stop the fleabags, sir. They came in too hot to handle. wecudntstoptheflebags3sahr5theycameintoohottohandel RA45,81,01,435,81,01,A50,81,02, That's not acceptable. We lost a full company of Marines aboard. thatsnotackseptabil6welahstafuldivishunofmareensaboord R645,81,01,635,81,02, That's going to reduce the effectiveness of our ground troops fighting on Kurasawa IV. thatsgointoredoocetheefektivnesofargrowntroopsfitinonkurasawathee RA45,81,01,A35,81,01,A50,81,02, You've let me down, $C. I expect that won't happen again. uvletmedown4dipstik5ieckspectthatwonthapinagayn 620,R81,01,A35,81,01,A45, No sir, it won't. nosahr4itwont RA35,81,01, Let's review what happened out there... Letsrevoowhathapinedowtthir RA45,81,01,A35,81,01,A50,81,02, 14, $C got $K of the hairballs... dipstikgotsumoftheharbahls 15, You came off without a kill, $C... ucaymafwithowtakil2dipstik 16, and $L for Bossman. andsumkilsforbahsman 17, and none for Bossman. adnanforbahsman 1,18, I commend you on bringing back the Ralari. icumenduonbringinbaktheralari RA45,81,01,A35,81,01,A50,81,02, 19, And $C ... I'd like to talk to you in my office in two hours. addipstik4idliketotalktouinmyafisantooowrs RA45,81,01,A35,81,01,A30,81,01, Dismissed. dasmasd U K F o p 8hF K No Take a load off, $C. I've got good news. takalodaf3dipstik5ivegotgudnoos 245,R81,02,A45,81,01,A35,81,01,A50, We just got a report from the seige force over Kurasawa IV. wejusgotareportfromtesejforsovrkurasawafor RA45,81,01,A35,81,01,A50,81,02, The CSS Suffolk just torched a Kilrathi communications station. teteseassafokjastorjdakalratecamunacatansstatan RA45,81,01,A35,81,01,A50,81,02, That should keep those Kilrathi jerks in the dark for a while. thatshudkeepthostkilrathijerksinthedarkforawhile R81,01,A45,81,01,A35,81,01,A30, 2,5, My regrets about Bossman ... he was a good man myregretsabotbasman4hewasagudman A45,81,01,235,R81,01,240,81,01,A50, I'll let you know if I hear anything else. See you, $C. illletyouknowifiheranythangels5seeu2dipstik 235,R81,01,A35,81,01,A40,81,02, A 9 h A 2 m7 07 FG2 E ef ef Good day, $C. Heard you're flying a Rapier these days. gudday3dipstik5hirdthatuvgottentoflytheraypear RA45,81,01,A35,81,01,A50,81,02, Is it really as quick as everyone says? I've got to see it in action. isitrealeaskwikasevrewonses4ivegottoseeitinackshun 235,R81,01,A35,81,01,A50,81,02, I just got back from a patrol out near Kurasawa IV.That was a nightmare. ijustgotbakfromapatroloutnerkerwasawatoo5thatwasanitemar RA45,81,01,A35,81,01,A50,81,02, Me and Lightning were jumped by a couple of wings of Gratha. meanliteninwirjumpedbyacupleafwingsofgratha R81,01,A35,81,01,A30, We managed to take out five of them before they got Lightning. wemanadstotakowtfivafthembefartheygotlitenin RA45,81,01,435,81,02,A50,81,02, If we'd had those Rapiers, I bet that we'd never have taken a hit. ifwedhadthosraypears4ibetwednevarhavtakinahit R245,81,01,A35,81,01,A50,81,02, They're good ships. You're lucky to get to fly one out. thirgudships5yoorlukeetogettofliwonowt RA45,81,01,235,81,01,A50,81,02, U 1 U K u v K iA A 67 Konichi-wa, $C-san. Do you have time to share? greetins2dipstik5doyouhavtimtospare 120,R81,01,A35,81,01,A40,81,02, I am inspired by the reports of our sucesses. We are doing well. Iaminspiarbytereportsofarsucseses5weardoinwell R81,01,A35,81,01,A30, Still, I am sure that there are many battles left to be fought. stil4iamsoorthatthirarmanebatelsleftobefaht RA35,81,01,A35,81,01,A40,81,02, The Kilrathi will not be vanquished until they are beaten on their own territory. thekilrathiwilnotbevankwisheduntiltheyarbetinanthironteritore R81,01,135,81,01,A40,81,01, Beware a desperate enemy, $C. They will stop at nothing to defeat you. bewayradesperatinime3dipstik5theywilstopatnothintodefetu RA35,81,01,A35,81,01,A30,81,01, Until we meet again. untilwemeetagayn R145,81,01,135,81,01,A50,81,02, 9 J 3 4 P 5 6 a y z U Uy U z F a F KZ ab U 9 Z YF F 5Ed FGq , , $xy z K 7n op op Mission Briefing.Kurasawa System, $T hours, $D. All right, people...here's what we've got. okpepul4hirswhatwevegot We've received a tight-band transmission from the Formidable, an Exeter-class destroyer. weverecevedatietbndtransmishunfromtheformidabul3aneckseterclasdestroyer She's just come from a scrap, and she's in rough shape shesjustcumfromascrap3ansesanrufsap Your mission will be to rendezvous with her, and guard her against further attack. yoormisunwillbetorandavuwithar4angardheraginsfrthratak RA45,81,01,235,81,01,135,81,01, Hunter and Waxman, you get the duty. Hunter will fly lead. hunterandwacksman4ugetthedoote5hunterwilflyleed RA45,81,01,235,81,01,A30,81,02,240,81,01, Excuse me, sir? eckooseme3sahr 75,R81,01,135,81,01,135, I served on the Formidable back at the Academy. iservedontheformidabulbakattheakademe R145,81,01,135,81,01, If possible, I'd like this mission. afpasbal3idliktasmasan R145,81,01,135,81,01, 2,10, Very well, $C, you and Bossman get the nod. $C will take the lead. verewell3dipstik3uanbahsmangetthecall5dipstikwilltaktheleed 130,R81,01,135,81,01,A40,81,01, 2,11, Very well, $C. Understand that you're on your own. verewell3dipstik5understanthatyooranyoorown 130,R81,01,135,81,01,A40,81,01, Thank you, sir. thanku2sahr 130,R81,01,135,81,01,A40,81,01, Here's the flight plan. herstheflitplan Computer, display Chi. camputir3displayky A45,81,01,A35,81,01,R250,81,02, You are to proceed directly to the Formidable, which jumped in at Nav 1. The destroyer has reported a minefield between Nav 1 and the Claw. Once you've arrived at the rendezvous point,you'll escort the destroyer back here. You should return via Nav 2, and avoid the minefield entirely. youshudretirnveahnavtoo4andavoidtheminefeldentirele Be on guard. The Kilrathi would love to take out an Exeter-class ship. beongard5thekilrathiwoodluvtotakeoutaneckseterclasship Dismissed. dismised $ F , g F F q Z Z ; F R K rs K 01x K HZ hirz Z U OU PUtK K P oZ Z ;kd d Mission debriefing. $T hours, $D. 1,7, Good to have you back. What's the status of the destroyer? gudtohaveubak5whatsthestatisofthedestroyer RA30,81,01,A40,81,01, She's been put into tow, and is powering down for repairs. shesbinputintoto4andispowirindownforrepars RA30,81,01,A40,81,01, Good. You've earned us one more ship we have to use against the hairballs. gud5yuvarnduswonmorshipwehavtouseaginsttheharbahls RA30,81,01,A40,81,01, 2,5, Both of you have done a fine job out there. R81,01,A35,81,01,235,81,01, 2,7, I heard about Bossman. He was a good pilot. ihirdabowtbahsman5hewasagudpilot A40,81,05,R435,81,03,A50,81,02, 13, 1,13, What happened to the Exeter, $N? whathapendtotheeckseter4shepdip RA40,81,01,640,81,01, We couldn't stop all of the Kilrathi, sir. There were too many. wecudntstopalofthekilrathi3sahr5thirwirtoomany RA35,81,01,435,81,01,A50,81,02, We needed that ship, $C. There's no time to wait for a replacement in our strike force. weneededthatship3dipstik5thirsnotimtowatforareplasmintinarstrikfarce 610,R81,01,A45,81,01,A35,81,02, We've already gotten our next operation order. We're leaving tomorrow. wevealredegotenarnecksoperashunordir3werlevagtomorow RA45,81,01,A35,81,01,A50,81,02, You need to do better, $C. I've come to expect results from you. youneedtodobeter3dipstik5ivecumtoeckspectresultsfromyou. RA35,81,01,A45,81,01,A30,81,01, Yes sir. yesshar RA15,81,01,A35,81,01,A30,81,02, Let's review your performance... letsrevooyoorperformans RA45,81,01,A35,81,01,430,81,01, 15, $C, you destroyed $K of the Kilrathi fighters. dipstik2yoodestroyedsamaftekalratesaps 16, You didn't score at all, $C... youdidntscaratal2dipstik 17, and Bossman killed $L. andbahsmankilledsum 18, and Bossman came up blank. adbahsmancameupblank 1,20, Why don't you go and see Commander Della Guardia on the Formidable? whydonyoudgoanseecumandirhimlokontheformidabul RA45,81,01,A35,81,01,A50,81,02, She's already asked to meet her escort. sesalredeaskdtomeethiseskort$44 RA45,81,01,A35,81,01,A50,81,02, 21, Stop by my office after mess, $R. I'd like to speak with you. stopbymyafisaftermes3shepdip5idliktospekwithyoo RA45,81,01,A35,81,01,A50,81,02, Dismissed. dasmasd ? F b c Z 7P WXP lZ FZ F Good morning, $R. How's tricks? gudmornin3shepdip5howstricks A5,R81,01,A40,81,01,A35,81,01,A50, Have you seen the news trids that they're showin' in the mess hall lately? haveyouseenthenoostradsthatthirshowininthemeshallately RA40,81,01,A35,81,01,A40,81,01, Mostly reruns, last I saw. mostlereruns3lastisaw R81,01,A45,81,01,A35,81,01,230, I mean, can't we ever get any new shows?What happened to the Confederate News Network? imen3cantweevirgetanynooshos4whathapenedtothecunfederatenoosnetwerk A45,81,01,235,R81,01,240,81,01,A50, It's getting harder to know what's going on before everyone else does around here. itsgetinhardertonowhatsgoinonbefarevrywonelsdosarounhir R81,01,A35,81,01,A40,81,01, After all, I've got a reputation as an omniscient bartender to uphold. afterall$3ivegotareputashunasanahmnisintbartendirtouphold$30m R81,01,A35,81,01,A40,81,02,220, K 8 K X Y K 5aK K K IK efK ef Say there, mate. Got a minute? saythir3mate5gotaminut RA35,81,01,A35,81,01,A40,81,02, I've 'ad a chat with the Colonel. 'E says we'll be flyin' together soon. iveadachatwiththekernel5eseswellbeflyingtogethirsoon 235,R81,01,A35,81,01,240,81,02, Let me give you a few notes on my style...before we launch. letmegivyouafewnotedonmystile4befarwelaunch RA45,81,01,235,81,01,240,81,03, Right off, I'm not as crazy as some people say. I've just got me own ways. rightaff3imnotascraseassumpepulsay5ivejustgotmeownways R245,81,01,230,81,01, 'Long as we take a crack at any fuzzballs we see, I'll be 'appy. longaswetakacrakatanyfusbahlswesee3ahlbehape RA45,81,01,235,81,01,A50,81,02, Also, it never 'urts to check out ev'ry angle. Even if that means going against the plan. also3itnevirhurtstochekowtevreangul5evenifthatmensgoinagainsttheplan R81,01,235,81,01,140,81,02, After all, you just might find something you'd miss otherwise. afteral3youjustmitfindsumthinyoodmisotherwis RA45,81,01,A35,81,01,A50,81,02, Z P J h P t u P 3K IJf $R. shepdip RA45,81,01, Looks like we've got the hairballs on the run. lukslikwevgatteharbalsanteran RA45,81,01, But I won't sleep well until they're out of the sector... batiwontslepwalantaltarowtaftesaktor RA45,81,01, Still, I'd like to get my hands on one of them... stal2idlaktugatmyhansanwanaftam RA45,81,01,A35,81,01, ...face to face... fastufas 625,R81,01,A30,81,01,A45, ...to answer for what they did to my family on Vega VII tuansarforwattadadtumifamleanvagasavn R645,81,01, m C I d 1 2 3 4 v w 2 x y 2 Hx 2 yz 2 B 2 bc 2 b 2 0 2 12q 2 2 2 uv w w? wAkl wmn w 2 2 9k 2 2 'g Mission Briefing.Rostov System, $T hours, $D. Settle down, people. We've got a job to do, so let's get to work. As you know, Rostov System has been off limits for authorized colonization... asyunop3rastavsastamhasbanaflamatsforatorizdcalanizatan ...because of the presence of the native sentient species, the Mopoks. becasaftepresensaftenatavsanteanspeses3temapaks Yet the system contains a profusion of mineral-rich asteroids... yattesastamkantansaprofusanafmanralrajastrods ...attracting the attention of the Empire of Kilrah. atraktagteatantanafteampirafkalra RA40,81,01,A35,81,01,A50,81,02, Unfortunately, the Kilrathi don't place the same importance on alien races that we do... anforunatlep3tekalratedonplastesamamportansanaleanrasastatwedu R235,81,02,145,81,01,A50,81,02, ...so we're here to defend the system, its natives and its resources. sowerhertodefantesastam3atsnatavsadatsresorsas R81,01,A45,81,01,235,81,01,130, We've received reports from our scientific missions on the third planet... wevresevdreportsframarsiantafakmasnsantetardplanat ...indicating the presence of Kilrathi warships in the system. andakatagteprasansafkalratewarsapsantesastam Our first job here is to recon the system, and locate all hostiles. arfrstjabherasturekantesastamp3adlokatalhastils $C, you'll lead the first patrol wing. dipstikp3yulledtefarspatrolwag 15,R81,01,A30,81,01,140, Iceman will fly your wing. RA35,81,01,A30,81,01, Here's your mission plan. You'll recon four potential jump points on this one. We suspect the Kilrathi are running supplies near Nav 2 or 3... ...so be especially alert in those areas. And keep your eyes open for asteroids... ...there are several rather dense asteroid fields in the area. Any questions? anekwestans Colonel, if we spot supply ships near Nav 2 or 3, do we engage? karnalp3afwespatsaplisapsnernavtuortrep2duweangaj RA35,81,01,135,81,01,140,81,01, Your call, $N. But if you decide to go for it, make sure you make it count. yurcalp2luserp5batafyudesidtugoforatp2maksuryumakatcont R145,81,02,130,81,01, We can't allow the Kilrathi to establish a base in this system. wekantalotekalratetuastablasabasantassastam Squadron dismissed. $ , M f 8 abc dh 6c 6 V X M NSz 1w $ DKr Zs Zs Mission debriefing.$T hours, $D 70,8, Glad to see you back aboard, $C. gadtosiubacabord3dipstic RA35,81,01,A35,81,01,A40,81,02, 3,5, He looked good out there, Colonel. helukdgudotter2karnal R145,81,01,A45,81,01,A40,81,01, You both did, as I expected you would. Good job. yewbotid3asiecspectiduwud6gudjab 120,RA35,81,01,A40,81,01,A50,81,02, 12, 6, Too bad about Iceman. At least he took some furballs with him. tubadabotisman7atlisthituksumfurbalswitim RA30,81,02,445,81,03,A40,81,02, 7, Too bad about Iceman. I wish he had taken some furballs with him tubadabotisman7iwishihadtakinsumfurbalswitim RA30,81,02,445,81,03,A40,81,02, 12, 70,12, I see you made it back...somehow. isiumaditbac5sumhaw R645,81,01,650,81,01,635,81,02, You flew like you slept through flight school. yewfewlakusleptruyertransims R640,81,01,635,81,01,630,81,01, 3,11, I will be watching you both. Slip again and you won't see the flight deck soon. awilbewatinubot5slipupaginanyuwontsiteflitdecsoon 625,R81,01,A45,81,01,A35,81,01,A50, Remember, if you lose the edge out there, you'll be the next pilot sealed in a box. remimer3ifulostedawter4yulbetenectpilotweburi RA45,81,01,635,81,02,650,81,01, Let's review the mission report. letsrifiwtemisonreport RA45,81,01,A35,81,01,425,81,01, 14, You destroyed $K of the enemies, $C... yewdistroidsufunofteinimi3dipstic 15, The log shows you bagged nobody, $C... telogsowyubagudnobodi4dipstic 16, ...and as expected, Iceman tagged $L. asecspectid5ismantagdefun 17, ...and suprisingly, no kills for Iceman. adsuprisinli4nokilsforisman 3,18, The recorder also shows you downed a Kilrathi supply ship. Good work. telogalsososudawndakilratisuplisip6gudwurk 3,19, You blew a chance to kill a Kilrathi supply ship. That may cost us, $C. yublewacanstokilakilratisuplisip5tatmacastusdirli 640,R81,01,A35,81,01,A30,81,01, 3,20, And sadly, Iceman didn't make it back. adsadli3ismandiduntmaikitbak RA35,81,02,445,81,02,A30,81,02, 21, Report to my office after your shift, $R ... we have some business to discuss. reportomiofisafuryersif3dipstic6wehafsumbisnistodiscus RA45,81,01,A35,81,01,A40,81,02, That is all. Dismissed. tatasal5dasmasd 2 A q 2 2 892 Ey2 2 W2 2 Y2 2 Here we are at Rostov System, $C. You ever hear much about it? herwearatrastavsystam2dipstik4yuavrhermajabotat RA35,81,02,A35,81,01,A30,81,01, Her third planet's a jungle world, with a native race of primitive sentients. hartardplanatsajanglwrld3watanatabracafpramatavsanteans RA45,81,01,A35,81,01,A50,81,02, That means the Confederation won't colonize officially, except for scientific missions. tatmenstecanfadaratatanwonkalanizofasalep2aksepforsiantafakmasns RA45,81,01,235,81,01,A25,81,02,130,81,01, Of course, that just leaves the planet open for unregulated settlement. afcorsp3tatjaslevsteplanatopanforanragulatadsatlman RA45,81,01,A35,81,01,A50,81,02, Grey towns is what they call these unauthorized colonies. gratonsaswattacaltesanatorizdkalanes RA45,81,01,A35,81,01,A50,81,02, They're full of the usual spaceport scum-and-villainy crowd. tarfalafteusualspasportskamadvalanecrod RA45,81,01,A45,81,02,A50,81,02, There's a little place on Rostov III I know, Rita's Cantina... tarsalatlplasanrastavtreinop2retascantena RA45,81,01,A35,81,01,A50,81,02, Great place to visit, but don't go in uniform gratplastuvasat2batdongoanunaform$99 RA45,81,02,A35,81,01,A40,81,02, If you go, tell Rita ol' Shotglass sent you...she'll look after you while you're there. $3afyugop3talretaolsatglassanyup5sellukaftryuwilyurtar RA45,81,02,A35,81,01,A40,81,02, 2 4 2 2 $2 HI2 52 5 G'day $C. Grab a chair and have a cold one, mate. gudai3dipstic6grabasaranhafacawldun4mait 420,A10,R81,01,A40,81,01,A35,81,01, Best way to ready yourself for a good scrap. bestwatorediurselforagudscrap RA40,81,01,A35,81,01,A30,81,02, 3,5, That's your opinion, Hunter. tatsuropinon5huntur 425,81,01,245,R81,02,A45,81,01,A35, That it is, mate. After all, someone's got to show our boys how to relax. tatitis3mait5aftural3sumunsgotasowarboishawtorilacs$50 410,R81,01,145,81,01,135,81,01,A40, But don't let the Colonel catch you tippin' before a mission, though. butontletecernalcatsutipinbiforamison4to R445,81,01,435,81,01,A50,81,02, 2 2 . T n 2 2 2 2 2 ;t2 2 78j2 78j $C. dipstik R145,81,01,135,81,01,A50,81,02, Rostov System's full of asteroids... rastavsastamsfalafastrods RA30,81,01,A35,81,01,A50,81,02, ...heavy mineral resources. havemanralresorsas RA40,81,01,A35,81,01,150,81,02, Since the Confederation's never officially settled it... sanstecanfadaratansnavrofasalesatldat RA35,81,02,A55,81,01,A35,81,01, ...'cause of the native sentients... casaftenatavsanteans R145,81,01,135,81,01,140,81,02, ...we're us at a disadvantage defending against the Empire. weratadasavantajdefandagagansteampir RA45,81,01,A35,81,01,A50,81,02, That just makes Rostov more attractive to the Kilrathi. tatjasmaksrastavmoratraktavtutekalrate RA45,81,01,A35,81,01,A50,81,02, Minerals, jungle world, primitive race for slaves... manrals2janglwrld3pramatavrasforslavs RA45,81,01,A35,81,01,A50,81,02, The hairballs want this one bad...I can feel it. teharbalswantaswanbadp4icanfelat R645,81,01,635,81,01,650,81,02, 9 W 1 2 F 3 4 G T K U V P E U FG 28 Z U Hp K a d ,Agh ,ij U ? Mission Briefing.Rostov System, $T hours, $D. Listen up, people. lasanap2pepl The Kilrathi are strengthening their position within this system. asecspectid3tekilratiarstrintininterpasitonwitintesistim Tactical reports several new bogies jumping in around the system. taktaklreportssavralnubogesjampaganarodtesastam We've just gotten a confirmed fix on a Ralari-class destroyer. atispint4wefconfurmtipresinsofatlistwunralariclasdestroir RA45,81,01,235,81,01,A50,81,02,135,81,01, 3,6, $C, you and Iceman get this one. R145,81,01,135,81,01,A30,81,02, 3,7, $C, you've got this one to yourself. R135,81,01,135,81,01,A50,81,02, We can't let them keep that kind of firepower at our backs. wecantletemkiptatkinduffarpawuratarbaks R245,81,01,A35,81,01,140,81,01,A30,81,01, Your mission will be to engage the Ralari and destroy it. yurmisonwilbetoingajteralariandestroiit RA45,81,01,A35,81,01,A50,81,02, We don't have a tactical report of its escort ships, but rest assured they'll be there. wedontafataticalreportofitsescorsips4butrestasurdtelbeter 430,R81,01,A45,81,01,A35, We're counting on you to succeed. 140,R81,01,A35,81,01,A40, 3,12, We'll take her down, sir. wiltakurdawn3sur RA35,81,01,145,81,01,A40,81,02, Here's your strike plan... hirsurstrikplan If the Ralari moves as we expect... A45,81,01,A35,81,01,R250,81,02, ...you should encounter her at Nav 1. You'll have to fly through an asteroid field... ...but that should allow you a measure of surprise. butatsulalawuamesurofsupris Colonel Halcyon assigns the rest of the squadron to investigate other bogies. ...which should provide a safe corridor for our reinforcement ships. Squadron dismissed. $ P , J P K Q K F Z P 2 K DE K $I K ij F A EcA diA 7 A 9P YF d OPgvd OPgv Mission debriefing. $T hours, $D. 1,6, Good work, $R gudwurk4dipstic 3,4, You too, Iceman. You both did your job well. yutu2isman4yubotidurjabwel No problem. noprablam A10,R81,01,A40, The destroyer never stood a chance, sir. tedistroirnefurstudasans4sur 225,R81,01,A45,81,01,A35, 3,11, Even though they had us outnumbered and outgunned. efentoteyadmeawtnambirdandawtcunt$10 RA45,81,01,A35,81,03,A50,81,01, 1,11, Couldn't take her out, eh, $C? cuduntakerawt2adipstic RA40,81,02,A35,81,01,A40,81,01, No, sir. I'm sorry. nosar4imsare A10,430,R81,02,A35,81,02,A40,81,03, That costs us, $C.We can't afford to risk another crack at her. datkastsasp2dipstik4gifintasitatun5wicanafordtoriskanotercracatur A40,81,01,420,81,01,630,R81,01,A40, If we can't reestablish a position of strength soon... ifwicanrestablisapositonofstrintsoon RA45,81,01,A35,81,01,A50,81,02, ...we just might lose this system. wejustmitlustisystam RA25,81,01,A35,81,01,A30,81,01, Let's go over your mission log... letsoveryurmasnlag RA35,81,02,A45,81,01,230,81,01, 13, Report shows $K Kilrathi for you, $C... reportsosforkalsforyu2dipstik 14, Report shows no kills for you, $C... reportsosnokalsforyu2dipstik 3,17,3,16,15, and $L for Iceman. adfivkalsforisman 16, and none for Iceman. adnanforisman 3,17, And we've lost Iceman. adwiflostisman A25,81,01,A35,81,01,R435,81,02, 1,18, Again, good job on taking out the Ralari. agin4gudabontakinawteralari RA45,81,01,A35,81,01,A40,81,02, 19, And $N...come to my office after you've finished your shift. adcorpal5cumtomiofisafurufinisdursift RA30,81,01,A35,81,02,A50,81,02, That's all. Dismissed. tatsal4dasmasd A 6 K ,K FG2 2 Hey, $C. You look like a man who could use a drink. halo3dipstic7uluklakamanhocudusadrink 245,R81,02,A45,81,01,A35,81,01,A50, I've invented a new drink named for this system... ifinfintidanudrinknamdfortisistim RA45,81,02,A35,81,01,A35,81,02, I call it the Rostov Hairball... icaliterastafharbal A25,R81,01,240,81,01,A30, ...for all those Kilrathi ships on the rocks out there in the asteroid fields. foraltoskalratesapsanteraksottaranteastrodfelds$99 A25,R81,01,240,81,01,A30, Stop by when you're off duty and we'll have one. stapiwinurafdutiadwilafun 235,R81,01,A35,81,02,A50,81,01, A K O P 2 RK rsA DmF F Hello, $C. Have a seat. halo3dipstic6hafaset RA45,81,01,A35,81,01,A40,81,02, I hear the Kilrathi are hungry for the minerals in those asteroids out there. ihertekalratearhagrefortemanralsantosastrodsottar 135,R81,01,A45,81,01,A40,81,01, My guess is that they'll try to send in some heavier ships... migesistateltritosanansumhefirsips RA45,81,02,A35,81,01,A30,81,01, ...so its probably a good idea to hang onto a couple of missiles... soatsprobleagudidatuhagantuacaplafmasls RA35,81,02,A50,81,02,A50,81,01, ...in case you meet something big in the later stages of a mission. ankasyumetsamtagbagantelatrstajasafamasn RA45,81,01,A35,81,01,A50,81,02, That way, you'll still have something with punch to throw at the big boys. tatwap2yulstilhavsamtagwatpanjtotroattebagbos RA30,81,01,A45,81,01,A35,81,01, A 7 b c K 9A ? UV l l Hey there, $C. How's it goin'? heter3dipstic4$3hawsitgon$5m 415,RA25,81,01,A30,81,01,A20,81,01, I sure wish that I could see some more action. isurwisaticudsesumoracsun 81,01,225,R81,01,A15,81,01,A20, But the Commander won't let me on the flight deck. butecomandurwonletmionteflitec A20,R81,01,435,81,01,430, He's still upset about that 'sport that I accidentally skragged... hestilupsetabotesimitartatilawstonpatrol R625,81,01,630,81,01,635,81,01, Man, it wasn't my fault...I can't control a missile once its launched man2atwasnmifaltp5ikantkantrolamaslwansatslanjd R81,01,515,81,01,525, No one can How am I supposed to stop it from acquiring a Drayman as its target? nowankan3howamisposdtustapatframakwiragadramanasatstargat R81,01,515,81,01,525, Besides, a transport should know enough to stay out of a fighter's way. besids3atransportshunoenaftustaotafafitrswa R625,81,01,630,81,01,635,81,01, , r 1 2 2 3 4 K F 4S K TU K D K dj K I K ij2 67x ,yz , ,78pq ,rs K 2 56Wm no no Mission Briefing.Rostov System, $T hours, $D. Let's go, people. There's no time to waste. letgopipal4tersnotimtowast About an hour ago, Tactical got a fix on a large bogie jumping into the system. wifdatatctatalarjbogitatintartesistimabotunarago We don't know what she is, but she's big.Very big. wedonowatitis3butitbig4varibig We need a visual on her, so Tactical can decide what to do about her. wenedavazulanhar3sotaktaklkandesidwattuduabothar R235,81,01,140,81,01,A50,81,02, 3,6, $C, you and Iceman are going to go take a look. dipstic3uanismanargoagtogotakaluk R140,81,01,135,81,01,140,81,01, 3,7, $C, I want you to go out and get a look at her. dipstic3iwanyutugootadgatalukathar R140,81,01,135,81,01,140,81,01, Find out what you can,but make sure you get back with a report. fidotwatyukan3batmaksuryugatbakwatareport RA45,81,01,235,81,01,140,81,01, And watch your back...the Kilrathi wouldn't send her in alone. adwaturbacs5takilratiwudantsinurinalon R230,81,01,135,81,02,A50,81,02, Understood, sir. andarstood3sar A10,R130,81,01,135,81,01,A30,81,02, Good. Now let's go over the scenario... good4harswarsisbinspatid We have a fix that puts her here, near Nav 2. A45,81,01,A35,81,01,R250,81,02, You can proceed through Nav 1, avoiding the asteroid field along the way... A45,81,01,A35,81,01,R250,81,02, ...or you can pick your way straight through the rocks. Tactical says neither route is significantly better, so it's your call. Do you have any questions, $C? duuhafanicwestans3dipstic R135,81,01, No sir. nosar 45,R130,81,01,A35,81,01,A35,81,01, Good. Let's get out there, then. gudp4latsgatottar2tan Squadron dismissed. $ 2 - L F h F 7P F ?jF P -.P 01P - P MN P 5 P F H P Z ABi 2 2 JQx 2 2 ?d 2 ef P P l 2 2 6d F ef Mission debriefing. $T hours, $D. 2,13, Let's have that report, $R $N. nisjab2dipstik 3,26,2,9, Yes sir. We couldn't get too close...just near enough to ID her class. yasir5wecudngetuclaws4jasniranaftoideerklas RA35,81,01,A30,81,02,A40,81,01, Based on your sighting, what is she? baistonursitin4watisi A45,81,01,A35,R81,02,250,81,01,235, Definitely a Fralthi-class cruiser. The situation was too hot to risk a close pass. definatliafralticlascrusir5tesitwatonwastohatorisaclospas 120,R81,01,A45,81,01,A35, Very well, $C. Now we'll begin assembling a strike force. variwal3dipstic5nawilbeginasimblinasakfors A15,81,01,RA35,81,01,A40,81,01, I'd like to play a part in that sir. idlaktaplaapartintat4sar R81,01,A35,81,01,A40, No, you've done your job. no3ufdanurjab RA35,81,01,A35,81,01,A40,81,02, 17, Yes sir. We were able to get a close look...she's definitely a Fralthi-class cruiser. yasar4wewerabaltogitaclosluk4sisdafanitliafralticlascrusar RA40,81,01,A35,81,01,A30,81,01, 'Bout as big as the 'Claw, and easily faster. botasbigatecla3anesalifaser A15,R81,01,A35,81,01,A30,81,01, Good work. We've already got a strike team on stand by, ready to engage her. gudwark3wevalradegatastriktemanstanbi2radetuangaghar RA35,81,01,A35,81,01,450,81,02, 17, You've got a lot of nerve coming back to this ship, Mister. yufgatalatofnerfcaminbaktotisip4mistir R630,81,01,625,81,01,635,81,01, When I give you an assignment, I intend for you to carry it out. winigifuanasinmin3ianatforutocaritawt R630,81,01,125,81,01,635,81,01, Without any data on that bogie, we're withdrawing from the system. becasofurfalur3winawaftoliftisistim4anatmacatusdirli R630,81,01,625,81,01,435,81,01, If we weren't strapped for pilots, I'd ship you back to Proxima ifwiwrnsapidforpalat3idbusubaktansinansipubaktapracsamasintarifor R630,81,01,625,81,01,A35,81,01, Were you able to bag any of the enemy? weruabaltobaganioftainami RA35,81,01,A35,81,01,A50,81,02, 19, No sir. I wasn't. nosir5awasn R445,81,02,A35,81,01,A50,81,02, 20, Yes sir. I got $K of the hairballs. yasar4igatsefanoftaharbals RA35,81,01,A30,81,01,A30,81,02, 3,23, And you, Iceman. How many did you get? anu3asman5hawmanididuget R130,81,01,135,81,01, 22, None sir. nun2sar 420,RA20,81,02,140,81,02, 23, I killed $L, sir. akiltsefun3sar R140,81,02, 24, Very well. $C, report to my office in one hour. variwel5dipstic3ripartomiafisinwanar That's all. Dismissed. tatsal5dasmas 32, Yes sir. We were able to get a close look...she WAS a Fralthi-class cruiser. yasar4wewerabaltogitaclosluk4sisdafanitliafralticlascrusar RA40,81,01,A35,81,01,A30,81,01, 'Bout as big as the 'Claw, and easily faster. botasbigatecla3anesalifaser A15,R81,01,A35,81,01,A30,81,01, I don't know how you managed it $C... idonowhowumanejdit5dipsstic ...taking out that Fralthi will certainly shake up the Kilrathi command. takinowtatfralthi5wilsertenlishakupthercomand Let's go over your mission log... letsoveryurmasnlag RA35,81,02,A45,81,01,230,81,01, 17, A ; e dK K 'iK K Have a seat, $C. This place is getting empty these days. hafasit3dipstic5tisplaisisgetinemitisdais 245,R81,02,A45,81,01,A35,81,01,A40, I hear you've been flying the Raptor.She's a good ship, fast but a bit clumsy. ihirufbinflinarapor5sisagudsip3fasbatabitclamsi RA45,81,01,A35,81,01,A50,81,02, It's an aggressive ship...if you're an aggressive pilot. itanagrasafsip3afuranagrasafpalat RA45,81,01,A35,81,01,A50,81,02, I'd bet you could stand off a Gratha or two with that kind of ship. idbetucudsanafagrataortowitatanafsip R81,01,240,81,01,A50, Oh well...you've probably got a better feel for the ship than me. owel3ufprababligatabetarfilfortasipanmi A45,81,01,235,R81,01,240,81,01,A50, Pay no mind to this ol' has-been. panoatantantoteolhasban A45,81,01,235,R81,01,240,81,01,A50, 7 B 7 7 4c2 7 ;a7 7 Bonsoir, mon ami. bansor3manami5acanatsip4soacumtotaracrumantat 420,RA25,81,03,A35,85,81,02, I have heard that the Kilrathi are sending in their best pilots... ihafurtatekilratiarsenininterbaspilats 130,R83,81,01,435,81,01,A50,81,02, It is my goal to encounter with one of their aces and shoot him down. itismigoltorandafoowitanafteraisisansootimdawn RA35,81,02,A35,81,02,A30,81,03, But, I have not had the chance to engage one yet. but3ihafnatadesanstoenajwanyat A10,410,R81,02,A35,81,01,A40,81,02, If you are so lucky, you will try to kill him at all costs, non? ifuarsoluki3uwiltritokilimatalcast3no RA35,81,01,735,81,01,A30,81,02, That is the best way to ensure our victory. tatisebaswaitoansurarfictori RA35,81,01,A35,81,01,A40,81,02, 7 7 K Q 7 Q7 qw7 23x7 27 UV7 6p7 7 ?7 A7 A Greetings, $C-san. gritins3shepdipsan RA35,82,81,01,A35,81,01,430,81,02, 6,2, Have you heard what happened to Lt. Marshall on his last mission? havyuhrdwathapndtulutananmarsalanhaslasmasn 135,R81,01,A35,81,01,A40,81,02, 6,3, Have you heard what happened to Lt. Bhutto on his last mission? havyuhrdwathapndtulutananmarsalanhaslasmasn RA40,81,01,135,81,01,A30,81,02, 4,4, It is remarkable that the brilliant young lieutenant has not yet destroyed the Tiger's Claw atasremarkabltattebraleanyaglutananhasnatyatdestrodtetigrscla R645,81,01,635,81,03,635,81,01, He was pursuing a Dralthi as it rushed toward one of our transports. hewasparsuagadralteasatrasdtordwanafartransports RA45,81,01,435,81,03,82,130,81,01, He locked a heat-seeking missile on its exhaust and launched... helakdahetsekagmaslanatsexhasadlanjd RA45,81,01,435,81,03,82,130,81,01, ...but at the last minute, the Dralthi looped back towards him. batattelasmanatp3tedraltelupdbaktoardsham RA45,81,01,435,81,03,82,130,81,01, The missile lost its lock on the enemy,and acquired the transport as its target. temasllastatslakanteanamep2adakwirdtetransportasatstargat RA45,81,01,435,81,03,82,130,81,01, The transport's engines were severely damaged,and the ship was soon destroyed. tetransportsanganswarsaverledamajd2adtesapwassundestrod RA45,81,01,435,81,03,82,130,81,01, It is vital that one consider what is beyond his target before firing... atasvitltatwancansadrwatasbeanhastargatbeforfirag RA45,81,01,435,81,03,82,130,81,01, ...as the lieutenant's unfortunate example demonstrates. astelutanantsanfortunataksampldamanstats RA45,81,01,435,81,03,82,130,81,01, M , 8 9 d ? d A B h F Z Z Z Z Nn Z P j P P p wKL wMN w 2 2 Ga Mission Briefing.Hubble's Star System, $T hours, $D. 2, All right, boys and girls. Listen up. alrit2bosadgrls3lasnap Things haven't gone well for the Confederation.In fact, they're pretty sour. tinsafatganwelfartacanfedaraton5infac3terpreitisar We've got to stop the Kilrathi here.The colonists in this system are counting on us. wifgatostaptekilratiir6tecalonitinisistimarcontinonas I'm sending out several wings to scout the area... imsindinawtefralwintoscatearia3widonafacluwatater 420,R81,01,235,81,01,130,81,01,A30, Hunter, you and Flashfire will fly the first run. hantar3uanflasfirwilflitefartun A15,R230,81,01,235,81,01,A50,81,02, $C and Bossman will fly backup. dipsticanbasmanwilfibacup R145,81,01,135,81,01,A50,81,02, 1,11, 'Scuse me, Colonel. I've 'eard Dakhath Deathstroke may be in this system. scusmi3curnal5ifurtdakatdestrokmabenisistim RA35,81,01,A35,81,01,A35,81,01, That's the initial report.We haven't confirmed it yet, though. tatsteanatalreportp5wehavnkanfrmdatyat2to R235,81,01,A35,81,01,A30,81,02, Remember, people...Dakhath is ruthless.He'll try to kill you in your ship, or out of it. remambr2pepl5dakasisrutlis4hiltritokiluinursip2orawtafit A10,R245,81,01,A35,81,01,A50,81,02, Computer, display Kappa campwtr3displakapa Your patrol should be uneventful, $C.We're expecting some fuel tankers soon... ...so we need to be sure the nearby jump points are clear of hostiles. Do a thorough sweep of the areaand return to the 'Claw with a report. Questions, gentlemen? kwastans3gintalmin RA35,81,01,A30,81,01, Very well. Let's look sharp, people. variwal5letsooksarp3pipal R81,01,A35,81,01,A35,81,01,A40, Squadron dismissed. $ F , L e 2 2 . NSTU P VZ P U x Z Z P OV P Kz 2 2 92 ?f2 2 2 2 2 CkK OPij OPij Mission debriefing. $T hours, $D 75,8, Glad to see you back aboard, $C gadtosiubakabard3dipstic RA35,81,01,A35,81,01,A50,81,02, 3,5, $C did a job out there. dipstikdadwalottar RA40,81,01,135,81,01,A40,81,02, You both did well, as I expected you would. Good work. ubotidwel3asaecpetiduwod5goodab 140,R81,01,A40,81,01,A35,81,02, 12, 6, Too bad about Bossman. At least he took a few furballs with him. tubadabatisman5atlititooksamfarbalswitim A5,430,R81,03,A35,81,02,A40,81,02, 7, Too bad about Bossman. I wish he'd taken some furballs with him tubadabatisman5iwisiadakinsamfarbalswitim A5,430,R81,03,A35,81,02,A40,81,02, 12, 75,12, I see you made it back...somehow. isiumaditbak4samhaw R645,81,01,650,81,01,635,81,02, You flew like you slept through your flight training uflulakusleptruurtransims R645,81,01,635,81,01,650,81,02, 2,11, I'll be watching you both. Slip again and you won't see the flight deck soon. ilbiwatinubot5slipaginanduwonsitaflitdeksoon 625,R81,01,A45,81,01,A35,81,01,A50, Remember, if you lose the edge out there,you'll be the next pilot we seal in a box. ramimbar3ifulotaedawter4umabitanectpalotwibari RA45,81,01,A35,81,01,A50,81,02, Let's review the mission report. letrefutamisonrepart RA45,81,01,A35,81,01,425,81,02, 14, You destroyed $K of the enemy, $C... udetroidsavinafteanimi3diptik 15, The log shows you bagged nobody, $C... telagsosubatmobadi3diptik 16, as expected, Bossman tagged $L. asecptectid3asmantagtafin 17, and suprisingly, no kills for Bossman. ansuprisinli3nokilsfarasman 3,18,4,18, The log also shows you downed a two Kilrathi supply ships. Good work. telagalsososudawntakilratisuplisip5gudwark 3,19,4,19, You blew a chance to kill two Kilrathi supply ships. That may cost us down the line. ubluacanstokilakilratisuplisip5tatmaicastusdirli RA45,81,01,A35,81,01,A50,81,02, 2,20, And sadly, Bossman didn't make it back. ansadi3ismanidinmakitbak RA35,81,02,435,81,02,A30,81,02, 21, Report to my office after your shift, $R ... we have some business to discuss. ripartomiafisafurursift3dipstic5wihafsambisnistodiscas RA45,81,01,A35,81,01,A50,81,02, Nothing else. Dismissed. P B F b c F .P K BVP vwd 0d 0 Hey, $C. Sure is quiet around here. ha3dipstic5sariscwitarondir RA45,81,01,A35,81,01,A50,81,02, Y'know, Hubble's Star sure isn't where I thought we'd make a last stand. ynop2hablsstarsurasnwaritotwedmakalasstan R81,01,A35,81,01,A30, I mean, we've got active colonies here...research stations, too. aftaral3wifgatactifcalanishir5reesarstatonsalso RA35,81,01,A35,81,01,A40,81,02, Coming here just invites those Kilrathi fleabags to strike our civilians. caminirjustinfitoskilratiflibakstostrikarsivilans 410,R81,01,A30,81,01,A35,81,01,A30, The thought of that steams me up. tatotoftatstimsmiap 630,81,02,640,81,02,RA40,81,01, You guys can't let us down, $C. You've got to beat those hairballs back. ugiscanletasdan2dipstic5ufgatobeetosharbalsaff RA30,81,01,A35,81,01,625,81,02,A30,81,01, If you don't, well... ifudon3wall RA30,81,01,435,81,01,A50,81,02, d 0 d 0 ? $ 8 9 P ; p P $ P DE K P jp P . K tu , BC,DE P 7C cd Mission Briefing.Hubble's Star System, $T hours, $D. As you all know, we're beginning to run low on fuel. asualno3wirbaginintorunloanful RA30,81,01,240,81,02,135,81,01, We've got fuel tankers inbound that will need escort to the 'Claw. terardraimansupisipsinbantatilnidanescortoteclaw R130,81,01,233,81,02,A40,81,01, With the Kilrathi strike force that's moved in here at Hubble's... witikilratistikforstatsmuvdanherathabls RA45,81,01,235,81,01,A50,81,02,135,81,01, ...we're expecting the furballs to try and stop our 'sports. wirecspactinafurbalstotrianstaparsports R235,81,01,A50,81,02,135,81,01,A45,81,01, 2,6, $C and Bossman will escort the first pair. dipsticanbasmanwilescartafirspar 125,A1,230,R81,01,A45,81,01,A30, 2,7, $C, you'll bring in the first pair solo.We can't spare a wingman for you. dipstic3ulbrinintanecspar6wicansparawinmanforyu R130,81,01,135,81,02, Hunter will take the last detail. hantarwiltaktalasdital 45,220,R81,01,240,81,01,A40, Computer, display Omicron. camputer3displaomnicran You'll rendezvous with the two Drayman tankers here, at Nav 1... ...then escort them back to the Tiger's Claw at top speed. You must protect them from any attackers.The 'Claw has to have that fuel. umusprotecimframaniatakars5teclawastuhavtatful RA50,81,01,135,81,01,230,81,02, Are there any questions? anicwestans R135,81,01,235,81,01,A50,81,02, Good. Let's bring those 'sports in clean. Squadron dismissed. $ - c d P e f P P $Y P P V P $ K P 7P A pq F 18 K Q jopqF rs F 5i2 F O F ov F ?SA sxA A ?A EsA tA d Igd hitd hit Mission debriefing. $T hours, $D. 2,10, Welcome back, $R. What's the status of Drayman Alpha? She's unloading her cargo now, sir. sisanlodinarcargonaw3sar A3,R81,01,A35,81,02,A40, 3,6, Drayman Beta will be docking soon. dramanbatawilbidakinsoon RA30,81,01,A35,81,02,A45,81,02, 2,5, Excellent. You and Bossman are both to be commended. ecsalant5uanbasmanarbotobecamindad 120,A2,220,R81,01,A35,81,02,A45, 2,6, Excellent. You are to be commended, $C. ecsalant5uartobecamandid3dipstic A10,R81,01,A45,81,02,A45, 3,22, We lost Drayman Beta sir. There were too many fighters to stop them all. wilasdramanbetasar5terwirtoomanifitarstostaptemal A15,81,01,425,81,02,RA35,81,01, 2,8, You both did what you could. We'll have to cope with the fuel we received. ubotidwatucood5wilhaftocopwittafulwiresifd RA35,81,01,A40,81,01, 2,9, You did what you could, $R. We'll have to make do with the fuel we received. udidwatucod3ranc5wilhaftomaktowitefulwiresift RA30,81,01,A40,81,01, 22, Welcome back, $R. What's the status of Drayman Alpha? We lost her to those fleabags, sir. wilastertotosfeebags3sar RA45,81,01,A35,81,01,A50,81,02, And Drayman Beta? andramanbeta RA45,81,01,A35,81,01,A50,81,02, 3,17, We brought her in sir. She's unloading her cargo now. wibratirinsir4sisunlowdinercargonaw RA35,81,01,A30,81,01,A20,81,01, 2,15, You both did what you could. We'll have to make do with the fuel we received. ubotidwatucood5wilhaftocopwitesupliswirasifd 45,RA30,81,01,A40,81,01, 2,22, You did what you could, $R. We'll have to make do with the fuel we received. udidwatucod3ranc5wilhaftomaktowitesapliswiresift 45,RA30,81,01,A40,81,01, 22, She's gone too sir. There were just too many fighters... sisgantoosar4terwirtoomanifitars 410,R81,02,A35,81,02,430,81,02, That's no excuse, $R. Do you understand how badly we needed that fuel? tatnoecsews3dipstic5douanarstanawbadliwineeditatful R630,81,01,640,81,01,650,81,02, Yes sir. yas2ar 430,R81,01,A35,81,01,430,81,01, 2,21, I don't think you do. Your failure, gentlemen,may force us to evacuate our colonies. idantinudo6urfalur3jintalmin3maforsastoabandanarcalanis R645,81,01,A35,81,01,450,81,02, 2,22, I don't think you do. Your failure, $C,may force us to evacuate our colonies. idantinudo6urfalur3dipstic3maforastoabandanarcalanis R645,81,01,A35,81,01,450,81,02, Let's review your mission report... letrefewatuacampist RA45,81,01,A35,81,01,450,81,02, 24, We show $K kills for you, $C... wesosafinkilsfaru3dipstic 25, Looks like you were blanked, $C... luksakuwarblanct3dipstic 2,28,26, and Bossman got $L of the hairballs. anbasmangataitaftaharbals 27, and Bossman came up empty. anbasmancamupampti 2,28, We lost Bossman out there. wilastbasmanawter A45,81,01,A35,81,01,R435,81,02, And we know about the 'sports. anwinoabatesports RA45,81,01,A35,81,01,A50,81,02, 30, I want to see you in my office later, $C. iwantuseyuanmiafclatr2dipstik Dismissed. dasmasd U G k q A 6 VWA AA abA ab Hey there, $C. Can I get you anything? haiter3dipstic6canigituanitin 245,R81,02,A45,81,01,A35,81,01,A50, 2,2, I hate to see Bossman go. He was a real pro. ihaitosibasmango5hiwasatrupro RA45,81,01,A35,81,01,A50,81,02, 2,3, It's good to see you and Bossman working together. itsgudtosiuanbasmanworkintogatur RA45,81,01,A35,81,01,A50,81,02, At any rate, I'd watch my back when you're out there. atinirat3idwatmibakwinurawter RA45,81,01,A35,81,01,A50,81,02, Scuttlebutt is, another furball Ace was shipped in to take us down. scutablutesatanuterfarbalaisasisptintotaikasdown RA45,81,01,A35,81,01,A50,81,02, S'pose to be their best shot. You might ask around, see if anyone's heard anything. sposetubiterbesat5umitaskaransifiniwansurdanitin A45,81,01,A35,R81,01,240,81,01,A50, K 7 F F -K MNvK K RmK Rm $R, have a seat. I want to discuss our next mission. dipstik2hafasit5iwanadiscasarnectmisan RA45,81,01,A35,81,01,A50,81,02, Personally, I enjoy flying with you... parsonali3ianjoiflinwitu RA45,81,01,A35,81,01,A50,81,02, ...but I think I've noticed something. butitinkifnotistamtin RA35,81,01,A35,81,01,A30,81,01, Sometimes, you seem to get a little excited under enemy fire. samtims3usimtogitalitalecsitidondarinimifar R81,01,A35,81,01,A40, Keep a cool head out there. If you don't, you might not make it back. kipacoolhedawter5ifudan3umitatmaikitbak RA35,81,01,A35,81,01,A30,81,01, I've been in this business a long time. ifbinintisbisnisalantim5 RA40,81,01,A35,81,01,A40,81,02, I don't like reporting that I lost my Wing Commander. idonlikripartinatilasmiwincamandir RA40,81,01,A35,81,01,A40,81,02, You're a good pilot, $N. Stay that way. uragodpilat3rank5statatwai RA35,81,01,A35,81,01,A40,81,01, 7 Z - z c K 'QfK K 7LK 7L Och, lad, this old body wasn't made to sit and wait. aclad3tisalbatiwasnamaidositanspin RA45,81,01,A35,81,01,A50,81,02, 3,7, I'm ready to fly me next shift...especially with Baktosh Redclaw in system. amreditofliminecsift4aspaslibaktasredclawansastam 235,R81,01,A35,81,01,A50,81,02, He's Kilrah's top gun, lad. You'd be wise to listen to ol' Paladin. hisertapgun3lad5udbiwistolisintoalpaladin RA45,81,01,A35,81,01,A50,81,02, He flies a Jalthi, so don't go head to head with him. hiflisajalti3sodantgohedohedwitim RA45,81,01,A35,81,01,A50,81,02, There's no reason to be civil with 'im... tersnorisantobesifal RA45,81,01,A35,81,01,A50,81,02, ...so if you get a clean shot at 'im, ya take it, lad. tersnorisantobesifal3soifyagetaclinsat4yatakit3lad A45,81,01,A35,81,01,R640,81,02, You'll need every break you can get. ulnidefribrakucangit 45,R81,01,A35,81,01,A35, , d g y 8 9 ; n ,-y K $Y P K P , K VW P S P ipK ,de ,fg A IJP 67 67 Mission Briefing.Hubble's Star System, $T hours, $D. We've got another Code Red situation here, people. wevgatanatrkodradsajuatanher2pepl As you know, we've dispatched most of our fighters to defend the colony on Hubble's Star IV. asyunop3wevdaspajdmosaforfitrstodefantekalaneanhablsstarfor The main strength of the Kilrathi in system is now attacking Hubble's IV... temanstragtaftekalrateansastamasnowatakagathablsfor RA45,81,01,235,81,01,A50,81,02,135,81,01, ...but thirty minutes ago, another flight of bogies jumped into the system. battartemanatsagop2anatrflitafbogesjampdantutesastam RA45,81,01,235,81,01,A50,81,02,135,81,01, These vessels disappeared among asteroids about 50,000 klicks from our position. tesvaslsdasaperdamagastarodsabotfaftetowsankliksframarposatan RA45,81,01,135,81,01,A50,81,02,240,81,01, With most of our fighters away,we're especially vulnerable... watmosafarfitrsawap3weraspaslevalnarabl RA45,81,01,235,81,01,A50,81,02,135,81,01, ...so I'm sending just one wing to recon these bogies... soimsandagjaswanwagturekantesboges RA45,81,01,135,81,01,A50,81,02,240,81,01, ...and perhaps make a quick strike against them. adparhapsmakakwakstrikaganstam RA45,81,01,235,81,01,A50,81,02,135,81,01, 2,10, $C, you and Bossman are going to go see what's behind those asteroids. dipstic3yuadbasmanargoagtogosewatsotbehintosastrods R135,81,01,145,81,01, 2,11, $C, you are going to go see what's behind those asteroids. dipstic3yuargoagtugosewatsotbehintosastrods R140,81,01,145,81,01, Computer, display Phi. camputr3diplafi RA30,81,01, The bogies were spotted at Nav 1...start looking for them there. Go see what they are, and evaluate any threat they pose to our position here. If the situation looks good, you can engage. $C, that's your call. iftasitasunlukood3ucaningaj6dipstic3tatsurcal R150,81,01,135,81,01,A30,81,02, Once you've handled them, return to the 'Claw for reassignment. wansufandildem3retarnotaclawforeasinmin A10,R145,81,01,A50,81,02, Any questions, $C? anicwastans3dipstic Very well. Report directly to me when you return. Dismissed. $ Z , Z Z , P EF P E F a P l K F 2 F C P Yf F 7c F y K d P A 16KA e7 A A HiF d d Mission debriefing. $T hours, $D. 2,2, I'm glad you made it back in time to assist, $C. I wondered if there would be a ship for you to come back to. imgladyumadatbakantimtuasast2dipstikp4iwandardiftarwudbeasaptoforyukambakto 2,3, I'm glad you both made it back in time to assist.I wondered if there would be a ship for you to come back to. imgladubotmaditbacintimtoasist5iwandardifterwasgontobiasiptocumakto R81,01,A35,81,02,A45, 1,10, All we saw at Nav 1 were some Krants, sir.No sign of a strike force. alwisawatnafunwarsamkrant5nosanafasikfas 15,R81,01,A35,81,01,A45, No, that force came here...and they brought their best with them. no2tatfarscamhir4anteybratarbeswitem A15,R81,01,A35,81,02,A45, 3,7,4,6, It would have been better had Bakhtosh Redclaw gone up in a fireball. itwudafbinbetaradbaktasredclagonapinafarbal R81,01,A35,81,02,A45, 4,7, Fortunately for us, Bakhtosh Redclaw won't be going home...ever. fortunatifaras3baktasredclawanbigonam3efar RA30,81,02,A50,81,02,A34,81,01, 2,8, You both did well. Repelling that assault surely cost the Kilrathi dearly. ubotidwal5repelanatasalturlicastekilratidirli A10,120,R81,01,A35,81,01,130, 2,9, You did well, $R. Repelling that assault surely cost the Kilrathi dearly. udidwel3dipstic5repelanatsalturlicastekilratidirli RA45,81,01,A35,81,01, 16, 1,16, I wasn't able to make out anything near Nav 1.There was no sign of a strike force. iwasantabaltomakotanytagnernavwan5terwasnosinofastrikfars R81,01,A35,81,02,A45, No, that force came here...and they brought their best with them. no3tatfarscamhir4anteybraterbespilatwitem RA30,81,01,A35,81,01, 3,14,4,13, It would have been better had Bakhtosh Redclaw gone up in a fireball. itwodafbinbetaradbaktasredclawganupinafarbal R81,01,A35,81,02,A45, 4,14, Fortunately for us, Bakhtosh Redclaw won't be going home...ever. fortunatlifaras3baktasredclawonbiganam4efar R81,01,A35,81,01,A40, 2,15, You both did well. Repelling that assault surely cost the Kilrathi dearly. ubotidwel5repalanatasaltsurlicastekilratierli A20,R81,01,135,81,01,A40, 2,16, You did well, $R. Repelling that assault surely cost the Kilrathi dearly. udidel3dipstic5repalanatasalturlicastekilratidirli R81,01,A35,81,01,A40, I've read the report of your performance in the assault... afredaripartafurperformansinteasalt RA35,81,01,A35,81,01,410,A30,81,02, 18, You wasted $K, $C... yuwastadfiv2dipstik 19, You didn't tag any fuzzballs, $C... yudontafanifuribals2dipstik 20, and we show Bossman with $L. adwesobasmanwatsevn 21, and Bossman came up empty. adbasmancamapamte And most importantly, the 'Claw repelled their attack. matimpartanli3taclawrepelteratak RA45,81,01,A35,81,01,A50,81,02, 23, $C, stop by my office in a half hour. adiwantuseyuanmiafaclatr2dipstik Dismissed. dasmasd U 3 P t u A At 7 78Se7 78Se We're scheduled to leave Hubble's Star tomorrow. wirscedultolifisistimtomarow 245,R81,02,A45,81,01,A35,81,01,A20, I just can't shake the feeling thatwe're running out on these colonists... ijuscansaktafilinatwiraninotanteskalanasts RA35,81,01,A35,81,01,A30,81,01, I mean, if we cut out,who's going to protect them? imin3afwekatot3watabotecalanis5hoosgointoprotactim A15,81,01,530,RA40,81,02, I'd feel better if the Tiger's Clawcould stick around another couple of days. idfilalatbetariftetigarsclawcoodstakaronanatarcupaladais RA30,81,01,A35,81,01,A30,81,01, Orders are orders, though. ordarsarordars3to A30,R81,01,435,81,01,440,81,01, K B K b c K RK rsK K 3K 3 Hey there, $C. 'ave a minute, mate? heter3dipstic5afaminat3mait RA45,81,01,235,81,01,250,81,02, Rumor 'as it those Kilrathi buzzards sent in another ace. rumarasitatoskilratibusardseninanatras R245,81,01,235,81,01,A50,81,02, I'd love to get a crack at 'im, mate. Maybe I'll get a chance yet. adluftogitacrakatim3mait5mebialgetacanyet RA45,81,01,235,81,01,250,81,02, I 'ear every available man's being sent to defend a colony under attack. framwatair3nirliafriafailabilmanbinsintodefandacalaniunaratak R245,81,01,A35,81,01,250,81,02, Of course, knowing my luck,I'll get stuck on some bleedin' patrol. ofcars3noinmilak3algitstukansamblidinpatrol 210,410,R81,01,235,81,01,410,A30,81,02, Ah well, the colonel knows best.Shotglass Another round for me and $C. awel3tecomandarnosbes5sotglas4anaterandformiandipstic 445,81,02,440,81,01,135,81,01,150,81,02, F , K L M F P P QkP Qk $C. halo3dipstic5uarwalcamaditantoanturir R145,81,01,235,81,01,A50,81,02, Come on, mate. You can be a bit friendlier than that. caman2mat5yukanbeabatfranleartantat 135,R81,01,135,81,01,A30,81,01, No reason to be friendly, St. John... noresantybefranlep2sanjan R245,81,01,A35,81,01,150,81,02, ...not after the way we all flew back at Port Hedland. nataftrtewawealflubakatporthadlan R145,81,01,135,81,01,150,81,02, No excuse for letting the hairballs kick us around that system. noakskusforlatagteharbalskakasarontatsastam 135,R81,01,A40,81,01, Maybe we'll even it up here at Hubble's... mabewelevanatapherathabls A15,R81,01,645,81,01,635, h Q D $ 1 2 3 4 b c K d e O F ij P V F rs Z Hq rs Z ;o Z , ,w Z Z g P hi P Bs Z F B Z XY P F HIv K Z Io Z pq Mission Briefing. Venice System, $T hours, $D. All right, boys and girls. Welcome to Venice. Confederate Sector Command believes this system is vital to the Kilrathi. canfediraticamanbeliftisitimisfitaltotekilrati Some intelligence reports indicate that Kilrathi High Command... sumintelajinrepartindicatatkilratisecorcamand A20,81,01,125,R81,01,A45, ...may be located in a starbase somewhere in this system. mabilocatidinatarbassamwirintisistim R145,81,01,235,81,01,A50,81,02, If that is the case, we need to find it as quickly as possible. iftatistecais3wenedufinditascwikliaspasibal R81,01,A35,81,01,240,81,01, We'll immediately commence an intensive schedule of recon patrols... wilimiditiatlicaminsanintinsifskedulafrecanpatrols R135,81,01,235,81,01,A35,81,01, ...to identify all vessels and large objects in the system. tuadintifialfesalsanlarjabjectintesistam The commander quickly assigns four wings to patrol missions. Yours is the fifth assignment. $C, you'll lead Epsilon Wing.I'm putting Hunter with you. dipstik3uleedepsilanwin5amputinhantirwitu Glad to be on your wing, mate gladubeanurwin3mait 15,R81,01,245,81,01,A35,81,01,A40, Here's your route, gentlemen. hirsurawt3gintalmin Computer, display Epsilon. camputr3dasplaapsalan You'll fly a four-point patrol. At the first Nav Point, you'll fly by one of our own Exeters. From there on out, though, you'll be in unknown territory. Now there's a lot of debris floating around out there... nawtersalatafdebreeflotinarawnowter ...and we believe that a lot of it is going to be Kilrathi mines. anwibeliftatalatufitisgointubekilratimins You'll be flying near debris at Navs 1, 2, and 3, so be careful. ulbeflinirdebreeatnafswan3too3antree3sobecarfal A10,R81,01,135,81,02,A50,81,02, And I want a report on the locations of any mine fields you encounter. aniwanaripartantelocaisansafanimanfilsuencawnter R130,81,01,140,81,02,A35,81,01, Any questions, $C? Hunter? anicwastans3dipstic5hantir R130,81,01,230,81,01, What kind of enemy ships do you expect us to encounter? watipafenimisipsduyuecspectasutencawnter R135,81,01,145,81,01, Since this is a major Kilrathi base system, we expect a strong enemy presence. sinstisisamajorkilratibaisistim3wiecspectatroninimipresans You could meet almost anything out there. ucudmeetalmosanitinawter R125,81,01,A40,81,01,A35,81,01, When we spot them, Colonel, do we mix it up? winwispaterm3kernal3duwimicsitap R225,81,01,240,81,01,235,81,01, $C'll have to make that call... dipsticalhaftumaiktatcal R240,81,02,235,81,01,140,81,01, ...but I'd recommend engaging anything up to a Ralari. butidrecomandingajinanitinuptoaralari Now, if there aren't any questions... naw3ifterarntanicwastans All right, then. Squadron dismissed. $ ' Z F F P RXF 22 LQRSF T F NF q 2 2 2 Lf2 2 62 LS 2 2 c2 2 CDbs2 2 2 ;B 2 2 PUVW2 XY2 2 st2 52 6;Yp2 qv2 2 2 ?D2 2 Mission debriefing. $T hours, $D. Welcome back, $C. Did you hit all your Nav Points? walcambak3diptic5diduhitalurnafpoints RA45,81,01,A35,81,01,A50,81,02, 3,26,2,25,1,25,0,25, Yes, sir, all four. yas3sar5alfor RA30,81,01,A35,81,01,A40,81,01, Run into anything unsual out there? ranintuwanitinunusualawtere RA45,81,01,A35,81,01, 1,5, Nothin' we couldn't 'andle, colonel. nutinwicudantandil3kernal 125,81,01,130,R81,01,A45,81,01,A35, 4,7,5,7, It was pretty routine, sir. It'll all be in the mission report. itwaspritirutin3sar5italalbeintemisanripart A15,R81,01,A40,81,01,A35, 27, 2,18, Met Khajja the Fang out near Nav 4, flying escort for a Ralari. metkajatefagawtnirnafor3fliinascartforaralari RA45,81,02,A35,81,01,A35,81,01, Oh? I'd heard he was in the system. How'd you do against him? oh5idirdiwasintasistim5hawduduagintim 75,RA35,81,01,A35,81,01,A50,81,02, 2,13,4,11, He got away, sir, but we did manage to blow the Ralari out from under him. higatawai3sar4batwididmanajtublowteralariawtfrumandirim RA45,81,01,A35,81,01, Well, that's what's important. We'll have other chances at the Fang. wel3tatswatsimpartant5wilafatircansisattefang RA45,81,01,A35,81,01, 4,27, He slipped by, sir, and the Ralari got away, too. hesliptbi3sar4anteralarigatawai3tu RA35,81,01,425,81,02,A50,81,02, Damn ... At least we know where they are now. dam5atlistwinowerteyarnaw 610,R81,01,A45,81,01,A35, 2,27,4,15, Nailed him, sir. Got the Ralari, too. naltim3sar5gateralari3tu RA20,81,01,A35,81,01,A40,81,02, Excellent job Congratulations, $C. ecsilantjab5cangratulasans4diptik$50 RA45,81,01,A35,81,01, 4,27, Took Khajja down, but the Ralari got away. RA45,81,01,A35,81,01, I see. Next time, I want you to concentrate on the big ship, though... asi5nectam3iwantutucansintwaitantebigsip3tow RA45,81,01,A35,81,01, ...even the best fighter pilot isn't as dangerous as a destroyer. efantebesfitarpalatisantasdanjirasasadistroir RA45,81,01,A35,81,01, 2,27, Ran into a Ralari with a squadron of Krant flying escort near Nav 4. ranintuaralariwitascwadranafkrantfliinescartnirnaffor A15,R81,01,A45,81,01,A35, Oh? How'd you do against her? o4hawduduagintir RA45,81,01,A35,81,01, 4,22, Got her, sir. gotir3sar$5m RA45,81,01,A35,81,01, Good job That's one less furball battleship for us to choke on gudjab$6tatwanlesfarbalbatalsipforastucokan RA45,81,01, 4,27, She got away, sir, but my computer has her route and speed on file. segatawai3sar4batmicampewtarasirrawtanspeedanfil RA35,81,01,A35,81,01,A40,81,01, That's what counts. I'll send a couple of wings after her. tatwatcawnts5alsindacupalafwinsaftirir RA45,81,01,A35,81,01, 27, No, sir. Ran into some trouble and had to turn back early. no3sar5ranintusamtrabalanadtutarnbakirli RA45,81,01,A35,81,01, 2,27,1,27,0,27, We got chewed up pretty bad at Nav 3, so I decided to pull the plug. wigatcewdupritibadatnaftree3soidesididtupultaplag RA45,81,01,A35,81,01, All right, then, let's go over the numbers... alrit3ten3letgoofirtenambirs RA45,81,02,A50,81,01,420,81,01, 29, You skragged $K of the Kilrathi fighters, $C... yuskragdsevnkalratefitrs3dipstik 30, I saw no kills for you, $C... isanokalsforyu2dipstik 31, and Hunter did in $L himself. adhantirdadansevnhamsef 32, and Hunter came up empty. adhantircamapamte 1,33, And the fleabags took out Hunter. adteflebagstokathantir RA45,81,01,A35,81,01,A50,81,02, 34, Oh, and $C, I want to see you in my office after you've cleaned up. o2adjezwiz4iwantuseyuanmiafazaftryuvclendap RA45,81,01,A35,81,01,A50,81,02, Dismissed. dasmasd 2 L 2 2 y2 2 a2 E2 ef2 6h2 6h So, $C, here we are in the Venice System, in the heart of Kilrathi space. so3diptik4hirwiarintefenasistim3intehartafkilratispais 245,R81,02,A45,81,01,A35,81,01,A50, Course, the hairballs have their own name for it ... Kharak Tar, I think. cors3teharbalshafterawnnaimforit3karaktar3itink A10,R81,01,A35,81,01,A30, Its habitable planet is a water world, like Port Hedland's. ithabitabalplanitisawatirwarl3lakenyos RA40,81,01,A35,81,01,A40,81,01, We call it Venice 'cause of ancient ruins on it, sinkin' into the ocean. wecalitfinascawsafansintrunsanit3sinkinintuteosan A45,81,01,A35,R81,01,240,81,01,A50, But the Killie-cats aren't supposed to like the water... batekilikatsarnsupostulaktewatir 215,R81,01,A35,81,01,A50,81,02, ...so they put their base in the system in an orbital station. soteyputerbaisintesistaminanarbitalstasan RA40,81,01,A35,81,01,A40,81,01, Tactical thinks if we find that station and take it out... tacticaltinsifwifantatsatunantaikitawt RA45,81,01,A35,81,01,A50,81,02, ...we'll take out the brains of the Kilrathi operations in the whole sector wiltaikawtebrainaftekilratiapiratansinteholsector R81,01,A35,81,01,A40, 2 ? n 2 2 ,-h2 2 67l2 2 $C, mate I understand we'll be flyin' together for a while. dipstik2mait5ianirstanwilbefliintugetarforawil RA45,81,01,235,81,01,240,81,01, Colonel's just moved me over to Black Lion squadron and Rapier fighters. kernalsjusmuftmiofartublaklianscwadrananrapirfitirs R240,81,01,235,81,01,A40,81,01, I can't wait to get out in one of these new Rapiers, mate icantwaitugetawtinwanaftesnurapirs3mait RA45,81,01,235,81,01,A30,81,02, As I recall, she's got both lasers and neutron guns, right? asirecal3sisgatbotlasirsannutranguns3rat R245,81,01,235,81,01,250,81,02, The lasers were designed for firin' at a distance... telasirswirdesandforfirinatadistans 245,81,01,235,R81,01,A50,81,02,A35, ...an' the neutron guns for extra punch up close antenutrangansforectrapunsapclos 210,R81,01,A45,81,01,A35, K ? m K K K K YK yzK .K ZK 7gK K AK A 2,1, Och, laddy, glad to 'ear that Khajja bloke was done in. oc3ladi4iranintutatkajablowkaginanmilaspatrol RA45,81,01,135,81,01,140,81,01, I 'ad a run in with Khajja a while back. oc3ladi4iranintutatkajablowkagin RA45,81,01,135,81,01,140,81,01, 'E's the coldest furball I've ever seen estecoldisfarabalifefarsin R145,81,01,135,81,01,A50,81,02, I was flyin' with Dragon, out of Yellowjacket squadron... iwasfliinwitdragan3awtufyelojakitscwadran RA45,81,01,135,81,01,A50,81,02, We ran into Khajja the Fang while we were flyin' watchdog on a tanker. weranintukajatefagwilwiwerfliinwatdagonatankir R145,81,01,A35,81,01,A50,81,02, We shot 'is wingmen to bits, and put 'is own shields and lasers out... wisatiswinmantubit3anputisawnsildsanlasirsawt RA45,81,01,A35,81,01,A50,81,02, ...but still 'e keeps comin' batilleekeepcamin 520,R81,01,135,81,01,140, We're tight on is tail, but 'e holds 'iscourse and fires off a missile. wirtitanistail3bateholdsiscarsanfarsafamisal RA45,81,01,135,81,01,130,81,01, One shot, right up the tanker's tailpipe, and she blows, big as day wansat3ratuptetankirstailpap3ansiblaws3bigasdai RA45,81,01,A35,81,01,A50,81,02, 5,9, An' while Dragon an' me are dodgin' 'er debris... anwildragananmiardajinerdebree R145,81,01,135,81,01,150,81,02, ...the hairy bastard makes 'is escape teharibastardmaiksisiscaip RA45,81,01,A35,81,01,A50,81,02, W $ c $ t 1 2 3 4 K K Hy P z P Eg K K K 45Z ,WX ,YZ , ,EF wGHSZ dZ Z HI Z 4 d NOfP gn F IF P K . . Mission Briefing.Venice System, $T hours, $D. After extensive reconnaissance of this section of the Venice System... ...our patrols have located and identified a number of Kilrathi vessels. arpatalsaflokatidanidintifidanambriafkilratifesals In our next several missions, we'll be engaging and destroying these ships. inarnecsefralmisans3wilbeingajinandestrointesips Our fighters will be working with fighters from the carrier Kyoto... arfitarswilbewarkinwitfatirsframtekarierkyoto RA35,81,01,135,81,01,235,81,01, ...which has recently joined us in the Venice System. wicasresintlijantasintefenasistim R135,81,01,A35,81,01,240,81,01, $C, you're first up with Nu wing. diptic3urfartapwitnuwin RA45,81,01, 1,8, I'll keep Hunter on your wing for now. alkiphantiranurwinfornaw R245,81,01,235,81,01,A50,81,02, You'll be going after a Fralthi with a couple of the Kyoto's fighters. ulbegoinaftirafraltiwitacapulafkyotosfatirs Computer, display Nu. campewtar3displanu R120,81,01, You'll rendezvous with two Rapiers, Foxtrot Wing, from the Kyoto, here. From this point, you'll proceed to Nav 1... ...skirting the edge of an asteroid field. Then you'll head on to Nav 2, the last reported position of the Fralthi. She can't be far from this point, and she's an awfully big bogie. You shouldn't have any trouble finding her. Questions? cwastans 1,18, I'd guess a Fralthi'd have a fighter escort, Colonel... idgesafraltidafafitarescort3kernal R230,81,01, 1,19, Do we know what sort of fighter escort the Fralthi has with her? duwinowatsartafatirescartefraltihaswitar RA35,81,01, She'll be well-guarded. Tactical says to look for Gratha on wide patrol... silbewelgardid5tactalsestulukfargrataonwadpatrol A10,R81,01,A40,81,01,A30, ...and either Salthi or Krant flying close escort. anetarsaltiarkrantflinclosescart A10,R81,01,A40,81,01,A30, Anyone else? aniwanels 2,24, Have we gotten a position on the main Kilrathi base in the system, Colonel? hafwigatinapositanantemainkilratibaisintesistam3kernal 210,R81,01,235, Not yet, Kien, but Tactical's narrowed it down to a few possibilities. natyet3kin4batacticalsnarowditawntuafewpasabilatis 230,R81,01,A40,81,01,125,81,01,230, 2,26, Have we gotten a fix on the main Kilrathi base in the system, Colonel? hafwigatinaficsantemainkilratibaisintesistam3kernal A10,R81,01,A40,81,01,A30, Not yet, $R, but Tactical's narrowed it down to a few possibilities. natyet3diptik4batacticalsnarowditawntuafewpasabilatis A30,R81,01,A40,81,01,A30, If that's it, then let's get into space. iftatsit3tenletgetintuspais Squadron dismissed. $ 2 2 E X 2 Y w Z Z P Z 12 P E P K ,U K klK ,ZK z K ?l K K K 23oK K K K QtK K A A 7 al - 2 2 d d Mission debriefing. $T hours, $D. 3,14,1,2, Excellent job, $R. ecsalintjab3diptik 1,4, Nicely done, gentlemen. naslidan3gintalmin 3,5, Don't make sport of us, Colonel. We did our best, but the ruddy bastard-- danmakspartufas3kernal5wididarbet3baterudibatard 65,RA35,81,02,440,81,01,235,81,01, 1,6,3,5, What do you mean, sir? The Fralthi got away ... we didn't even scare her. watuyamen3sar5tefraltigatawai3wedidantefanscarir 725,R81,02,A45,81,01,A35, 3,6, Thank you, sir. That Fralthi was a tough-- tanku3sar5tatfraltiwasatuf RA35,81,01,A40,81,02, Oh, the Fralthi, that's unimportant compared to what was in your computer. o3tefralti4tatanimpartantcampartuwatwasinurcamputar RA45,81,03,A40,81,01, Tactical started analyzing your log as soon as you arrived and downloaded. taticaltartidanalizinurlagasunasuariftandawnlodid R81,01,A35,81,01,A40, That Fralthi was in direct contact with the Kilrathi starbase... tatfraltiwasindirecantacwitekilratistarbais RA45,81,01,A35,81,01,A30,81,01, ...and Tactical can use the intelligence you gathered to find it antaticalcanusteintelajinsugatirdufindit RA45,81,01,A35,81,02, They'll have her location pinpointed within the hour teylafirlocasanpinpointidwitinteawr RA45,81,01,A35,81,01,A50,81,02, 1,12, Colonel, that's bloody incredible When do we go take 'er out? kernal3tatbladincredabal5wanduwegoantaikerawt RA40,81,01,A35,81,01,A30,81,01, 1,13, That's fantastic, sir When do we move against her? tatfantatic3sar5wanduwemufaginter RA40,81,01,A35,81,01,A30,81,01, Soon, very soon. For now, though, let's go over your mission report... sun3farisun5fornaw3to3letgofiryarmisanreport RA45,81,01,A35,81,01,A50,81,02, 3,21, Didn't even find the Fralthi, eh? didantefanfintefralti3a 610,RA30,81,01,A35,81,01, No, sir, I'm afraid not. no3sar4imafraidnat A20,R81,01,420,A20,81,01,A40, Well, then, it's your lucky day, because it doesn't matter. $5wel3ten4iturlakidai3becasitasinmatir RA45,81,01,A35,81,01,A50,81,02, Excuse me, sir? ecusme3sar 730,81,01,R81,01,A35, Tactical has managed to locate the Kilrathi starbase in the system... taticalasmanajtulocaitekilratistarbaisintesistim RA40,81,01,A35,81,01,A30,81,01, Once we've taken that out, the Fralthi you missed isn't going to matter. wanswiftaikintatawt3tefraltiumistisangointumatir RA45,81,01,A35,81,01,A50,81,02, But let's go over your numbers, just for practice... batletgofirurnambris3jusforpractis R81,01,A35,81,01,A40, Yes, sir. yas3sar RA40,81,01,A35,81,01,A30,81,01, 23, Computer credits you with $K Kilrathi, $C... campewtarcredituwitsafinkils3dipstik 24, Computer shows no kills for you, $C... camputirsosnokalsforyu2dipstik 1,27,25, and Hunter gets $L to boast about. adhantirgetsefinkils 26, and none for Hunter. adnanforhantir 1,27, And Hunter didn't make it back. adhantirdidnmakatbak A10,81,01,435,R81,02,A40, 28, And $C ... I want to see you in my office in an hour. addipstik4iwanttuseyuanmiafisananowr RA45,81,01,A35,81,01,A50,81,02, That's all. Dismissed. tatsal6dasmasd A N 7 A2 2 JU7 ,T7 nt7 Kt7 7 2,4,5,4, Hey, $C. I hear you ran into Khajja the Fang out there yesterday. ai3diptik5ahiruranintukajatefanawteryestirday 245,R81,02,A45,81,01,A35,81,01,A50, 2,2, Colonel said you did him in kernalsedudidimin RA45,81,01,A35,81,01,A30,81,02, 2,3, Too bad he got away... tubadigatawai 81,01,435,R81,01,A40,81,01,250, Man, that hairball's needed killin' since I was a rookie. man3datarbalsneedidkilinsinsawasaruki RA35,81,01,A35,81,01,A40,81,01, One of the pilots from Killer Bee squadron was in earlier... wanaftepilatframkilarbeescwadranwasinirlir 235,R81,01,A35,81,01,A50,81,02, 0,6,1,7, ...said that both Dakhath and Bhurak Starkiller may be here soon. sedatbotdakatanburakstarkilarmaibeirsun RA45,81,01,A35,81,01,A50,81,02, 0,9,1,7, ...said that Kilrathi ace Dakhath would be comin' to Venice soon. sedatkilratiaisdakatwudbecumintufenasun A10,R81,01,A35,81,01,A40, 0,8, ...said that ace Bhurak Starkiller would be comin' to Venice soon. sedataisburaktarkilarwudbecumantufenasun RA45,81,01,A35,81,01,A20,81,02, 0,9, 1,9, ...said the Kilrathi'd be sendin' their top aces after us soon. sedekilratidbesendintertapaisisaftirasun RA45,81,01,A35,81,01,A20,81,02, Thought you might like to know, so you could keep an eye out. totumaitliktuno3soucudkeepaniawt RA45,81,01,A35,81,01,250,81,02, K I K K gK K $cK K gK K TK K NK N 6,1, $C, have a seat. Lt. Marshall and I were just discussing tactics. diptik3hafaset5lutinantmarsalandiwerjusdescasintatics RA45,81,01,135,81,01,230,81,01, 6,2, $C, have a seat. I'd like to talk tactics with you. diptik3hafasit5idliktutaktakticswitu RA45,81,01,235,81,01,250,81,02, We're likely to be coming up against an increasing number of big ships. wirliklitubecaminapagintanincrisinambriafbigsips RA45,81,01,235,81,01,A50,81,02, It is important to know how to approach them. itisimpartantunoawtuaprostem R245,81,01,A35,81,01,230,81,01, When attempting to destroy a large ship, such as a Fralthi... wenatemtintudestroialargsip3susasafralti R81,01,A35,81,01,A40, ...I prefer to attack from the rear. iprefartuatakframterir R235,81,01,A35,81,01,A50,81,02, A large vessel's armor is always weakest around the engines. alargvesalsarmorisalwaiswekistarontenjins R245,81,01,235,81,01,250,81,02, 6,11, I hear the Kilrathi build 'em that way on purpose, Boss... ihirtekilratibildemtatwaianpurpos3bass R235,81,01,125,81,01,220,81,02, ...to make the captains keep their noses pointed toward the enemy tumaiksurtecaptinskepternosispointedowardenimi R115,81,01,230,81,01,220,81,02, I have heard that as well, Lieutenant... iafurdataswel3lewtinant R145,81,01,135,81,01,150,81,02, ...though I see no reason to believe Kilrathi captains are so cowardly. toisenoresantubelifkilraticaptinsarsocawardli RA45,81,01,235,81,01,250,81,02, K H o K K XyK K XK xK K ;lK ;l 2,1, The Bossman here might like to come at a big ship from behind... tebasmanirmitliktucamatabigsipframbein R225,81,01,115,81,01,A30,81,02, 2,2, A lot of flyers will tell you to come at a big ship from behind... alataflirswiltelutucamatabigsipframbehin 115,R81,01,A25,81,01,120,81,02, ...but I like to approach the big ones from the side. batiliktuaprostebigwansframtesid RA10,81,01,A25,81,01,420,81,02, They've got all their missiles to the front... teyfgataltermisaltutefrant R125,81,01,A15,81,01,130,81,02, ...and most of their guns to the front and the back. anmotaftergantutefrantantebak R215,81,01,435,81,01,120,81,02, 2,6, True enough. truenuf R145,81,01,A35,81,01,A50,81,02, If you come in from the side, you'll have time to get in close... ifucaminframtesid3ulaftimtugetinclos R215,81,01,A25,81,01,110,81,01, ....then you can really let the sucker have it tenucanrililetesukirafit$30 RA15,81,01,125,81,01,A20,81,01, z Z I' 1 2 3 4 M $ F Ss F F -.q M M ab Z Z U 6G,HIuv,wxw Z T P UV P P qrZ P f X P i Z Mission Briefing. Venice System, $T hours, $D. As some of you have heard, we've pinpointed this system's Kilrathi base. asamafuafird3wifpinpantidtisistimskilratibais The Tiger's Claw will begin to move into position to strike that base. tetagirsclawilbegintumufintupositantutiktatbais Because Venice is a vital Kilrathi system... becasfenasisafitalkilratisistim RA30,81,01,135,81,01,245,81,01, ...we expect significant resistance as we move the Claw into position. wecspecsignificanresitansaswimufteclawintuposisan R145,81,01,235,81,01,A50,81,02, For that reason, I'll be dispatching wings to fly on her flanks... fortatresan3albedispatinwinstuflionirflanks R245,81,01,135,81,01,A50,81,02, ...to head off any attacks from the sides as we move. tohedafaniataksframtesadsaswemuf The colonel assigns wings to fly above, below, and to port of the Claw. $C, you'll guard our starboard side. diptik3ulgardartarbardsid 1,10, Hunter will fly your wing again on this mission. hantirwilfliyurwinagainantismisan Here's your route... hersuruut Computer, display Phi. camputr3dasplafi This is essentially a three-point patrol... ...except that you'll rendezvous with the Tiger's Claw at Nav 3... ...instead of returning to the Claw's original position. Be on the lookout for any enemy vessels in the area. beantelukawtforaninimifesalsintearia It's safe to assume any Kilrathi you see is headed to attack the Claw... isaiftuasumanikilratiuseishedidtuatakteclaw R235,81,01,A35,81,01, ...so your orders are to immediately engage and destroy all enemy ships. sourardirsartuimediatlingajandistroialenimisips R235,81,01,A35,81,01, Any questions? anicwastins R235,81,01,A35,81,01, What kind of opposition are we looking at on this one, sir? watkindafapositanarwilukinatantiswan3sar 230,81,01,235,81,01,RA40,81,01, Hard to say, $C. This is a crucial base for the Kilrathi... ardusai3diptik5tiswanisacrusalbaisfortekilrati 210,81,01,240,81,01,RA40,81,01, ...so they'll send their best to defend it. sotelsinderbestudafindit RA25,81,01,240,81,01,A35,81,01, 1,23, Dakhath Deathsroke is supposed to be here, so I'd be watching for him. dakhatdestrokisupostubehir3soidbewatinforim RA25,81,01,140,81,01,A35,81,01, Now, if that's all the questions... naw3iftatsaltecwastans All right, then. Squadron dismissed. $ K 3 w P 0P PQP BP bcP ArP F Jk 2 F 2 B l F 2 d P 5P Ub P P b P 8F N2 2 4 JQdx P F 7i F F KP2 2 $P QXz F F Fi2 Z 8 XY Z Z EF F .x NOZbx NOZb Mission debriefing.$T hours, $D. 1,33,0,33, Glad you made it back, $C. Those Gratha were giving us a hard time. gladumaiditbak3diptik5tosgratawirgifinasahardime RA45,81,01,A35,81,01,A50,81,02, 2,6,1,4, It was just an accident that we got here in time, sir... itwasjasanasidantatwegatirintim3sar RA25,81,01,A35,81,01,A40,81,02, We only turned back early because I thought we were too shot up to go on. weonlitarnbakirlibecawsitatwewirtusatuptugoan RA45,81,01,A35,81,01, 1,27, It was just an accident that I got here in time, sir... itwasjastanacidentatigatirintim3sar RA25,81,01,A35,81,01,A30,81,02, I only turned back early because I thought I was too shot up to go on. iawnlitarnbakirlibecasitotiwastusatuptugoan RA25,81,01,A35,81,01,A30,81,02, 1,7, We ran into some opposition along the way, sir, but we got past 'em. weranintusamapositanalontewai3sar4batwigatpastem 125,R81,01,A35,81,01,A40, 1,8, I ran into some opposition along the way, sir, but I slipped past 'em. iranintusamapositanalontewai3sar4batislipastem RA45,81,01, We expected that. Just what did you come up against? wecspectidat5jaswatiducamupagint RA30,81,01,A40,81,01, 10, 1,20,4,20, Dakhath Deathstroke escorting a Ralari near Nav 3. dakatdetroakescortinaralarinirnaftree RA35,81,01,A35,81,01,A50,81,02, Dakhath, eh? You take him out? dakat3a5utaikimawt A5,720,R81,01,A45,81,01,A35, 1,16,3,14, Yes, sir, but the Ralari got away. yas3sar4bateralarigatawai RA45,81,01,A35,81,01, 4,27, Well, you either hurt her or scared her off, because we haven't seen her. wel3uetarurterarscarderaf3becasweafintseenir RA35,81,01,A35,81,01,A50,81,02, 3,27, Yes, sir. Blew the Ralari up as well. yes3sar5bluteralariapaswel RA45,81,01,A35,81,01, Excellent That explains why we haven't seen any big ships moving in. ecsalint6tatecspainswiwiafintseenanibigsipsmufinin RA20,81,01,A35,81,01,A40,81,02, 1,27,3,18, No, sir. He and the Ralari both slipped away. no3sar5heanterelaribotsliptawai RA45,81,01,425,81,01,A30,81,01, Hmmm. I wonder why they haven't attacked the Tiger's Claw, then. hmmm5iwandirwiteyafintataktetigarsclaw3ten A30,81,01,710,A20,R81,01,A40, 3,27, No, sir, he got away. But we did nail the Ralari. no3sar4hegatawai5batwedidnailteralari RA45,81,01,A35,81,01, If you had to make a choice, that was the right one. Good work. ifuadumaikacois3tatwasteritwan5gudwark RA45,81,01,A35,81,01, 1,27,1,27, Mostly a Ralari with a couple of Dralthi for escort. mostliaralariwitacupalafdraltiforescart RA45,81,01,A35,81,01, 3,23, They didn't get past us. teydidantgetpastas RA45,81,01,A35,81,01, Good job, $C. gudjab3diptik RA45,81,01,A35,81,01, 3,27, She got away, sir. segatawaiframas3sar RA45,81,01,435,81,01,A30,81,01, Well, she never made a run at the Claw, so she must've broken off. wel3senefarmaidaranateclaw3sosemastafbrokinaf RA45,81,01,A35,81,01,A50,81,02, 3,27,3,27, A few fighters. Nothing out of the ordinary, sir. afufitars5natinawtufteardinari3sar RA45,81,01,A35,81,01, Glad to hear it, $C. gladuhirit3diptik RA45,81,01,A35,81,01, All right, then, let's go over the numbers... alrit3ten4letgofirtenambirs RA45,81,01,A35,81,01,450,81,02, 29, You skragged $K of the Kilrathi fighters, $C... yuskragdsevnkalratefitrs3dipstik 30, I saw no kills for you, $C... isanokalsforyu2dipstik 1,40,31, and Hunter did in $L himself. adhantirdadansevnhamsef 32, and Hunter came up empty. adhantircamapamte 1,33, And the fleabags took out Hunter. adteflebagstokathantir 620,420,R81,02,A35,81,03,A30, 2,40, Just what do you think you're doing back here? jaswatutinkurdoinbakir 625,R81,01,635,81,01,650, You're rendezvous is still 60,000 klicks away urandayfuistilsistitawsankliksawai RA45,81,01,A35,81,01,A50,81,02, I thought it would be best if-- itotitwudbebesif R545,81,01,A35,81,01,A50,81,02, You don't get paid to think, mister. You get paid to fly udangetpaidutink3misar8urpaidufli R645,81,01,635,81,01,650,81,02, From now on, you fly when you're told, where you're told... R525,81,01,535,81,01,430,81,02, And right now I want you to fly your backsides down to the galley... anritnawiwantutufliurbaksidsdawntutegali R625,81,01,635,81,01,A40,81,01, ...while I send a real pilot or two out to do your job wilisendarilpilatortuawtuduurjab 645,R81,01,A35,81,01,A50,81,02, 41, And I want to see you in my office after you've cleaned up, $C. andiwantuseeuinmiafisaftrufclintup3diptik RA45,81,01,A35,81,01,A50,81,02, Dismissed. dasmasd 2 $ ; 2 2 $LK bcK ,VK lm2 2 Seen the news on the trid lately? sentenewsantetridlatli RA35,81,01,A25,81,01,A30,81,01, Looks like the Kilrathi are startin' to pull out of the sector lukslaktekilratiarstartintupulawtuftesector 210,R81,01,A45,81,01,A35,81,01,A30, We chased them out of Brimstone, Kurasawa and Gimle... wecaistemawtufbrimston3kurasawa3angimli RA35,81,01,A45,81,01, ...and now they're pullin' out of Tartarus and Nifelheim, too anawterpulinawtuftartarusanifelhim3tu R81,01,A35,81,01,A45,81,01,A30, It looks like Venice is goin' to be where they make their stand... itlukslakfenasisgontubewerteymaikterstand RA35,81,01,A45,81,01, ...and we'll be here to help kick them out of Vega Sector. andwilbehertuhelpkitemawtufegasector A10,R81,01,A35,81,01,A30,81,02, It's history in the makin', man itsistoriintemaikin3man$99 RA45,81,01,A35,81,01,A50,81,02, 2 B i 2 2 r2 2 ?2 2 .b2 2 0S2 0S I was thinkin', mate. There's somethin' we might want to try... iwastinkin3mait5tersamtinwimitwantutri R245,81,01,235,81,01,A50,81,02, 5,2, Paladin, 'ere, tells me tha' the furballs 'ave been plantin' mines around... niit2ir3telsmitatefarbalsafbinplantinminsarond 145,R81,01,A35,81,01,240, 5,3, I've 'eard the hairballs 'ave been plantin' mines around the system... afirdeharbalsafbinplantinminsarondtesistam RA45,81,01,A35,81,01, I was thinkin' we might try to use those mines to our advantage iwastinkinwemitrituustosminstuaradfantaj R245,81,01,A35,81,01,A50,81,02, If we're dogfightin' near a mine field, why not try to lead 'em into it? ifwirdagfitiniramanfild3winatrituledemintuit R81,01,240,81,02,235, There'll be more of them than there are of us... terlbemaraftemtanterarafas R245,81,01,A35,81,01, an' if we concentrate on the avoidin' the mines... anifwicansintraitanafoidintemans RA30,81,01,235,81,01,A30,81,01, ...while they're thinkin' of shootin' us, wiltertinkinafsutinas R81,01,A30,81,01,235, ...they might just run into a few mines by accident teymitjusrunintuafewminsbiacsidant 120,R81,01,A45,81,01,A35, ? c x V 2 e 78P hi hi Och, $C, lad. a3diptik5halo R145,81,01,135,81,01,A40,81,02, Things are lookin' up, aren't they? tinsarlukinap3arntey RA30,81,01,A35,81,01,A40,81,01, I've 'eard the Kilrathi are pullin' all their ships in... ifirdekilratiarpulinaltersipsin RA45,81,01,A35,81,01,A50,81,02, ...gatherin' 'em all 'round that starbase we've been lookin' for. gaterintemalarondatarbaiswifbinlukinfar R81,01,A35,81,01,A30, But they're s'posed to 'ave mined the system pretty 'eavily. batersupostuafmintesistimpretihefali RA35,81,01,A35,81,01,A50,81,02, 1,8, Not to worry, mate Their mines'll blow up their ships as soon as ours. natuwari3mait5terminsalbloaptersipsasunasars R145,81,01,135,81,01,A40,81,01, Hunter here thinks their mines can be used against them... hantirhirtinksterminscanbeustagintem 230,R81,01,235,81,01,A40,81,01,140, ...but I'm not so sure. batidanakan RA35,81,01, I say you can't be too careful when you're flying through a mine field isaiucantbetucarfulwinurflintruamanfild RA45,81,01,A35,81,01,A50,81,02, U 0 1 2 3 4 K K 3 K ? K M K mn K U K B CDn U 9 U Ar ' ,OP ,QR , ,JK K LMXaP biP $B P XY F c ;IS K TUy Mission Briefing.Venice System, $T hours, $D. All right, people, this is the big one. We've discovered that the enemy base here in the Venice System... wifdiscafirdateinimibaisirintefenasistim RA45,81,01, ...is the Kilrathi High Command for this entire sector. istekilratihicomanfortisantarsectar RA45,81,01, We'll be moving in for the final assault on the starbase today. wilbemufininfortefinalasaltantetarbaistudai RA45,81,01,235,81,01,A50,81,02,135,81,01, The Kilrathi will expect us to come in with all of our capital ships. tekilratiwilecspectatucaminwitalafarkapitalsips R235,81,01,A40,81,02,135,81,01, That means they'll be looking for us in a few hours. tatminstelbelukinfarasinafuars RA45,81,01,A35,81,01,A50,81,02, Tactical has determined that if we send in a handful of starfighters... taticalasdetarmantatifwisandanahanfalaftarfitirs ...we'll be able to hit them before they've gathered around the base. wilbeabaltuitembefarteyfgatirdarondebais We'll send several wings to punch through the perimeter to the base. wilsendsefralwinstupanstruteparimatirtutebais Here are the assignments for each wing... herarteasinmintfareswin The colonel quickly runs through the wings of Black Lion Squadron. 1,13, $C, you and Hunter will head straight in, along this route... diptik3uanantirwiledtraitin3alantisrut 1,14, $C, you'll head straight in, along this route... diptik3ulhedtraitin3alantisrut Computer, display Omega. campewtar3displaiomega A45,81,01,A35,81,01,R250,81,02, Your first objective is the Fralthi-class light cruiser at Nav 1. She'll have fighter escort as well... ...but you're just to slip past them--don't stick around to dogfight. Then its on to the Kilrathi base, here at Nav 2. There will be lots of fighters around the base, but try to ignore them. You're main objective is to take out that base. Questions? cwastans 1,23, What are we supposed to take the base out with, anyway, Colonel? watarwisapostutaiktebaisawtwit3aniwai4kernal R130,81,01,140,81,01, 1,24, What are we supposed to hit the base with, sir? watarwesupostuhitebaiswit3sar R130,81,01,140,81,01, Your missiles. Save them for the base... yarmisal5saiftemfartebais R130,81,01,140,81,01, ...because your ship's guns will be useless against anything that big. becasursipsganswilbeuslesagintanitintatbig R130,81,01,140,81,01, Anyone else? aniwanels All right, then. Let's get to work. alrit3ten5letgetuwark Squadron dismissed. $ 2 v F $P MkZ P Z tuF Ch K F i Z K Em K K Ip K Z $NF no K F K fgZ .P NUF P FGP P 'Rq K U ;M U ;M Mission debriefing. $T hours, $D. 3,12,1,2, Congratulations, $C You just finished the Kilrathi in Vega Sector cangatulasans3diptik5ujatfinistekilratinfegasectar 1,4, Congratulations, men You just finished the Kilrathi in Vega Sector cangatulasans3man5ujatinistekilratinfegasectar Oy, Colonel Don't go all misty on me oi2kernal5dangoalmistianmi$99 145,R81,01,A40,81,01,135, Thank you, sir. We were very lucky-- tanku3sar5wiwarfarilaki RA30,81,01,A40,81,02, 1,6, Now, 'old on there, mate I'd say talent 'ad a bit to do with it as well naw3oldanter3mait5idsaitalantadabituduwititaswel 145,R81,01,A35,81,01,A40, No false modesty, $R. You're entitled to be proud of what you've done. nofalsmadisti3diptik5urintatildubeprawdufwatufdan RA45,81,01,A35,81,01,A40,81,02, I suppose it was pretty impressive, wasn't it, sir? isapositwaspritimpresaf3wasintit3sar A15,R81,01,A35,81,01,A40, 1,9, I'd say so. You're the guest of honor at a little ceremony upstairs idsaiso5urtegestafanoratalitalseramoniapsters RA45,81,01,A35,81,01,A50,81,02, 1,27, 'At's the spirit, $C Let's go see Shotglass for a little celebration atespirit3diptik5letgosesatglasforalitalselibrasan R145,81,01,135,81,01,A50,81,02, Not so fast, there, Hunter... natsofas2ter4hantir R145,81,01,135,81,02, You two are the guests of honor at a little ceremony upstairs utuartegastafaniratalitalseramoniapters RA45,81,01,135,81,01, 3,27, Glad to see you back, $C. I followed you on the sensors. gladuseubak3diptik5ifalotuantesinsars RA45,81,01,A35,81,01,A50,81,02, You made a good run at it. We've got more ships moving in now. umadagudranatit4wifgatmorsipsmufininaw RA45,81,01,A35,81,01,A50,81,02, It's just a question of time before that base surrenders or blows. itjastacwastanaftimbefartatbaisarindarsorblaws RA25,81,01,A35,81,01,A40,81,02, I'm glad to hear it, sir. amgladuirit3sar RA45,81,01,A35,81,01,A50,81,02, That base was just too heavily guarded for one fighter wing. tatbaiswasjastuhefaligardidforwanfatirwin RA45,81,01,A35,81,01,A50,81,02, I understand, $C. But it was worth a shot. ianditrstan3diptik5batitwaswurtasat RA45,81,01,A35,81,01,A40,81,02, If you want, you can join me in Tactical to follow the battle. ifuwant3ucanjoinmiintaticaltufalotebatal RA45,81,01,A35,81,01,A30,81,01, 1,20,1,23, Thank you, sir. I'd like that. tanku3sar5idlaktat RA35,81,01,A40,81,01,A50,81,02, 1,26, I was plannin' on headin' to the Rec Room... iwasplaninanhedintuteracrum 110,R81,01,135,81,01,A30, ...so I could tilt a glass while I waited for news. Join me, $C? soicudiltaglaswilawaitidfornus5janmi3diptik R135,81,01,A35,81,01,A40,81,01, I'll go with Hunter, sir. We'll catch the news there. algowitantir3sar5wilcatenuster 230,R81,01,A30,81,01,A40, 1,26, Thanks, sir. But I thought I'd head for the Rec Room... tank3sar5batitotadhedforteracrum A10,R81,01,A35, ...maybe drink a toast to Hunter's memory. mabitrinkatostuhantirsmamaries A30,81,01,420,A10,R81,01,A35, Good idea, son. I'll join you down there, once things settle down. gudadia3san5aljonudawnter3wanstinsetaldawn RA30,81,01,A40,81,02,430,81,02, All right, then. Dismissed. alrat3ten5dasmast K 2 Y F K Dnd F U2 opA 9dA K 2PK pqU P OP O Hey, $C. You hear about Nifelheim and Tartarus? hay3diptik5uhirabotnifelheimantartarus 245,R81,02,A45,81,01,A35,81,01,A50, Our boys have kicked those damn hairballs out of both systems. arboisafkiktosdamharbalawtafbotsistims RA45,81,01,A35,81,01,A50,81,02, They had footage of the ground battle on Tartarus on the trid. teyafutajaftegrawnbatilantartarusantetrid A10,81,01,235,R81,01,A40,81,01,250, Man, it was great man3itwasgrait$10 RA45,81,01,A35,81,01,A50,81,02, Our marines, marchin' through the streets of the biggest Kilrathi colony... armarins3marsintrutetreetaftebigiskilratikalani 235,R81,01,A35,81,01,A50, ...linin' the fleabags up and loadin' 'em onto prison ships. lininteflebagsapanlodinemantuprisansips RA45,81,01,A35,81,01,A50,81,02, They're goin' to ship 'em back to Kilrah, lock, stock, and barrel. tergointusipembaktukilrah3lak3stak3anbaril RA45,81,01,A35,81,01,A50,81,02, Me, I'd put 'em to work minin' salt or harvestin' fungus... me3idputemtuwurkmininsaltarharfitenfangas R81,01,A35,81,01,A40, ...but I don't reckon that'd work out too good. batidantrekantatadwarkawtugud RA35,81,01,A35,81,01,A40,81,01, I'm just happy to see 'em bein' sent out of the Sector... amjastapituseembensentawtuftesector RA45,81,01,A35,81,01,A50,81,02, ...so we can have a little peace again sowecanafalitalpesagin RA45,81,01,A35,81,01,A50,81,02, 4,12,5,12, Pity this damn war's cost us so many good people. pititisdamwarscatasomanigudpipal 81,01,430,R81,02,A35,81,01,A40, 2 , 2 L M 2 J2 jk2 ;2 Uj2 2 ;m2 2 N2 2 Y2 Y Ah, $R $N. Bonjour. a3maijordiptik5bansur RA45,81,01,A35,81,01,A50,81,02, I have heard that the Kilrathi have sent all of their best against us now. ihavhertatekilratiafsintalafterbetagintasnaw RA30,81,01,A35,81,01,A40,81,02, Since Venice is the last contested system in the sector... sinsfenasistelascantetadsistimintesectar 425,81,01,RA30,81,01,A35,81,01, ...we will face the finest pilots they have left to them. wewilfaistefanitpaloteyafleftutem R81,01,A35,81,01,A30, I have been reading the records of their leading aces... iafbinredinterecardsafterledinaisis 230,R81,02,A40,81,02,A35, 0,7, 1,7, 2,7, 3,7, ...but it appears that their best known pilots have all died butitapirtaterbesnonpilatafaldied R81,01,A30,81,02,A35, 12, 1,8, To date, Dakhath Deathstroke has destroyed 86 of our starships and fighters. tudait3dakathdetrokasdetroid86afartartipsanfitirs R81,01,A45,81,01,A35,81,01, 0,9, Bhurak Starkiller has defeated 64 of our best pilots. buraktarkilarasdefetadsictifarufarbetpilat 140,81,01,RA45,81,01,A35,81,01, 3,10, The Baron Bakhtosh Redclaw has 75 kills to his credit. tebaranbaktasredclawassefuntifafkilstuiscredit R81,01,A45,81,01,A35, 2,12, Khajja the Fang leads the Empire of Kilrah with 99 victories. kajatefagledstemparufkilrawitnintininfictaris 220,R81,01,A45,81,01,A35, Mon dieu, I hope that none of us will be his hundredth mandu3ahoptatnunafaswilbeisandrit 510,R81,01,235,81,01,A35, 3 S s t 2 RS 9 9 Och, lad, I reckon this fight's just about over. oc3lad3arekantisflatjatabatofir RA45,81,01,A35,81,01,A50,81,02, About bloody time, too, that's what I say abotbluditim3tu3tatwatisai R81,01,A30,81,01,A35,81,01,A40, 10,5, I spent me entire career fightin' the Kilrathi... ispenmentircarirfitintekilrati RA45,81,01,A35,81,01,A50,81,02, ...you dinna ken how much it means to me to be here... udantnohawmucitmenstumetubehir R81,01,A33,81,01,A45,81,01,A20, ...now that we're about to run their fuzzy tails out of the sector nawtatwiraboturanterfusitailsawtuftesectar RA45,81,01,A35,81,01,A50,81,02, z t 9 P ; P P S K P 0u $E z ,,w56 F 78x P Z B U P Q Z RSm U P c P dk K Fn Mission Briefing.Hell's Kitchen System, $T hours, $D. I don't have to tell you that our backs are against the wall here... idontaftotelutatarbacsaragintewalhir Of all the systems the Confederation held in Vega Sector... ofaltesistimsteconfedurasuneldinfegasetor ...only Hell's Kitchen, Planck's Star and Alliance are still ours. onlielskitin3plankstar2andaliansarstilars RA45,81,01,235,81,01,A50,81,02,135,81,01, We've got refugee ships coming in from all over the sector. wifgotrefujeesipscomininfrumalofurtesector RA35,81,01,235,81,01,135,81,01, For the next few days, we'll be busy making sure they arrive safely. fortenecsfudas3wilbebisimakinsurteyarifsaifli RA45,81,01,135,81,01,A50,81,02,240,81,01, 1,7, $C and Hunter will take the the first run... jezwizaduntirwaltaktefurtrun 1,8, $C, you'll take the first run... dipstic3ultaktefurstrun Here's your flight plan... hersurflitplan You'll fly to Nav 1 to meet a Drayman jumping in from Chengdu. Bring her straight back here to the Claw. She'll be heavy with passengers, so she'll be moving slow. That 'sport will be carrying hundreds of civilian refugees, $C. tatsportilbicarigundridsofsivilanrefujees3dipstic I'm talking about children and old people... imtalkinabotcildrinandoldpeepol R130,81,02,140,81,01,135,81,01, ...not trained soldiers or mercenaries. notraindsoldirsormursinarees 120,R81,01,A40,81,01,A30,81,01,A25, So I want you to be very careful on this one. soiwantutobefericarfalantisan RA40,81,01,135,81,01,A30,81,02, The colonel quickly runs over the remaining assignments. hom2homontarain2wertadirantiantiloplai One more thing, people... wanmortin4peepol We know there is at least one Kilrathi cruiser already in this system. wenoterisatlastunkilraticrewsuralrediintissistim 2,20, We expect the enemy patrols near jump points to be heavy. wecspectenimipatrolsnirjumpointstobehefe 2,23, We believe several Kilrathi aces are on board... webelifsefrulkilratiasisaronbard ...including Khajja the Fang, whom some you have already met. 5,23, Bloody glad to hear it I'll be glad to 'ave another go at 'im bludegladoherit5albeglatoafanaturgoatem R640,81,01,630,81,01, So everyone look alert out there. Squadron dismissed. $ , t u v Z 6 VyK K 1Dr Z Z ,U LS F Y K Z 6cy P K k Z Z $ e 8K LSmZ K KZ kpd d Mission debriefing. $T hours, $D. 2,7, That was quite a feat, bringing a 'sport in through all those fighters. 3,3,2,3, Especially with Khajja leading one of the enemy squadrons espesaliwitkajaledinwonafteinimiscwadrans R81,01,A35,81,02,A45, Just did what had to be done, sir. jutidwatadtobedan4sar RA30,81,01,A35,81,01,A35,81,01, 1,17, Was bloody good, Colonel... wasblodigud4cernal A20,R81,01,135,81,03,150, ...gettin' the chance to do the Fang for all 'e's done to our mates getitacanstodotefanforalesduntoarmaits 115,620,81,01,640,R81,01,A35, 3,17,2,17, 2,17, I'm just sorry the fuzzball got 'way from us imjutaritefuzbalgotwafrumus RA35,81,01,435,81,01,A40,81,02, 2,17, I understand you lost your Drayman. iunurstandulastyerdraiman RA45,81,01,A35,81,02, I'm afraid so, sir. imafradso4sur A10,R81,03,435,81,04,435,81,02, 1,10, It's a bloody shame, all those families and kids... itsabludisaim5altosfamilesankids 430,81,04,630,R81,02,A35,81,01,A50, Don't take it too hard... dontakitooard R145,81,01,135,81,01,A50,81,02, Tactical badly underestimated the Kilrathi presence in the system. taticalbadliundurestamatedekilratipresinsintasistim RA35,81,03,A45,81,01,A30,81,01, There's not a pilot alive who could have brought that 'sport in... tersnotapilotalifocodafbrotatsportin RA30,81,01,A35,81,01,A50,81,02, 3,14, ...not through that kind of coverage. notrutatkindofcofaraj RA25,81,01,A35,81,01,A30,81,02, 3,17, ...especially with Khajja the Fang leading the final squadron. espesaliwitkajatafagledintefinalscwadran RA35,81,01,A33,81,01,A20,81,02, 1,17, I'd bloody well like to get my hands on that right bastard idblodiweliktogetmihansontatritbastard 610,R81,01,630,81,02,635, You're not alone in that, Hunter. urnotalonintat4hantar 15,R81,01,135,81,01,140, Let's run over the mission report... butletsrunofertamisanrepart RA40,81,01,A35,81,01,430,81,01, 19, You racked up $K of the hairballs, $C... uraktupsefanuftearbals3diptik 20, No kills for you, $C... nokilforu3diptik 1,23,21, and Hunter got $L of them. anduntirgatsefanaftem 22, and Hunter came up empty. anduntircaimupemti 1,23, We lost Hunter out there. welashantarowttar A45,81,01,A35,81,01,R435,81,02, 3,25, And you took out Khajja the Fang. bututukawtkajatefag RA45,81,01,A35,81,01,A50,81,02, Damn fine flying, taking that hairball down damfinfliin3takinatharbaldawn$30 RA30,81,01,A35,81,03,A50,81,01, 26, I'll want to see you in my office in an hour or so, $C. adiwantuseyuanmiafaclatr2dipstik Dismissed. dasmasd K 2 V z K d K KA A XF 67vA A So, $C. Here we are defending Hell's Kitchen... so3dipstic6herweardafandinhelskitin 235,R81,02,A45,81,01,A35,81,01,A40, ...and its third planet, Toadstool, the most miserable world in the sector. anitsurdplanit3todstul3tamotmiserabulwarldintasector RA40,81,01,A35,81,01,A40,81,01, Its hot and muggy, with nothing but overgrown fungus for trees... ithotadmugi3witnatinbatofargronfungasfortrees RA45,81,02,A40,81,01,A35,81,02, ...and no way to dry anything out. anowatodranitanawt R81,01,A35,81,01,A35,81,01,A40, Only reason anyone lives here is to harvest the molds and funguses... onlirisananiwanlifsiristoharfistamoldsanfungusis RA45,81,01,A35,81,01,A50,81,02, ...that go into the best antibiotics and vaccines. tatgoinotabesantibayoticsanfacseens RA35,81,01,A35,81,01,A40,81,01, Still, Toadstool's only got facilities for a few thousand folks... stil3todstalsonligotfasilitisforafutawsanfoks 235,R81,01,A35,81,01,A30, ...and refugees from the big colonies we've lost will be arriving soon. anrefugisfrumtebigalaniswiflastilbearifinsun R81,01,A35,81,01,A50,81,02,A40, There's more than 100,000 people coming in from Gateway alone. tersmoranwanhunridtawsanpeepalcamininframgaitwaialon RA35,81,01,A30,81,01,A30,81,01, It's gonna get ugly down there on the planet, $C. Mark my words. itsgonagituglidawnterontaplanit3dipstic5marmiwards RA30,81,01,435,81,01,435,81,01, K $ K a K 1K K HwK K K Back in a Scimitar again, eh, $C? bakinasimitaragin2a3dipstic RA45,81,01,A40,81,01,A50,81,02, Just be sure and remember her limitations, and you'll be all right. jusbesaranremimbarharlimatasans3anulbealrit RA35,81,01,A45,81,01,A40,81,01, She's slower than anything in the Confederate fighter fleet... seslowartananitininteconfederatfitarfleet RA45,81,02,A35,81,01,A50,81,02, ...but she's still a match for most of the Kilrathi fighters. butsilstilamatformosoftakilratifitars RA40,81,01,A35,81,01,A40,81,01, Try to get in close, where your mass driver guns are most effective... triangetinclos3warurmasdrifargansarmastafactif RA40,81,01,A35,81,03,A50,81,02, ...and don't forget that two of those missiles are dumbfire. andonforgitattoooftosmisilsardumfir RA35,81,01,A35,81,01,A40,81,01, They just fly straight out ahead of you, with no guidance system. teljusflistraitawtahedofu4witnogidansistim RA45,81,01,A40,81,01,A50,81,02, K h K K RK rsK Q K ?lK K UsU U Och, laddy, I ran into that Khajja bloke, not long ago. ac2ladi3iranintotatkajablowkaginonmilatpatrol R140,81,01,135,81,01,A40,81,02, 'E's the coldest furball I've ever seen eestacoldistfarbalifevarseen RA45,81,01,A35,81,01,240,81,01, I was flyin' with Dragon, out of Yellowjacket squadron... iwasflinwitragon4awtofyelojakitscwadran RA30,81,03,A50,81,01,A40,81,02, We ran into Khajja the Fang while we were flyin' watchdog on a tanker. wiranintokajatafagwilwewirfliinwatdogonatankir R145,81,01,A35,81,01,A50,81,02, We shot 'is wingmen to bits, and put 'is own shields and lasers out... wesotiswinmantobits3anputisawnsildsanlasirsawt RA45,81,01,135,81,01,A50,81,02, ...but still 'e keeps comin' butsileekipscamin 130,81,01,535,R81,01,A35,81,01,A40, We're tight on is tail, but 'e holds 'iscourse and fires off a missile. wirtitonistail3buteeolsiscorsanfirsawfamisal RA35,81,01,A35,81,01,A35,81,02, One shot, right up the tanker's tailpipe, and she blows, big as day wansat4rituptatankirstailpip3ansiblaws4bigasdai RA30,81,01,A45,81,02,A30,81,01, An' while Dragon an' me are dodgin' 'er debris... anwildragonanmeardojinerdibri RA45,81,01,A35,81,01,A50,81,02, ...the hairy bastard makes 'is escape teharibastartmaiksisescaip A30,81,01,630,81,01,635,R81,01,A35, S G 5 9 d ; d d K 5 P 67n P A 67 U d 4p , , P ?Z P .5u P Z Jf P d Z 45 A A Mission Briefing.Hell's Kitchen System, $T hours, $D. The situation is getting worse, people. thesituashunisgetinwirs3pepul The Confederation's lost Planck's Star... tecanfadaratanslosplankstar ...and the Kilrathi forces there will be headed for us next. anthekilrathifarcesthirwilbehededforusnecks Since we're expecting an increased hostile presence... sinswireckspectinanincresedhostulpresens RA45,81,01,135,81,01,240,81,01, ...we'll send wings to recon every bogie in the system. welsinwingstorekonevrebogeinthesistim R135,81,01,A30,81,01,240,81,01, $C, we've got a half-dozen bogies circling about 85,000 klicks out. dipstik3wevgotahafdusunbogessirklinabowtatefivthowkliksowt R145,81,01,135,81,01, 1,8, I want you and Hunter to go check them out. iwanuanhuntrtogochekthemowt 145,81,01,235,R81,01,130, 1,9, I want you to go check them out. iwanutogochekthenowt R145,81,01,A35,81,01,A50,81,02, Computer, display Theta. They're circling a point here, at Nav 1. It looks like they're waiting for something to jump in. It could be just a tanker or a 'sport... ...but it might be the first of the Kilrathi warships from Planck's. butitmitbethefirsafthekilrathiwarsipsfromplanks 1,15, Do we engage, colonel, or is this strictly recon? dowengag3kernel3oristhisstriklerekon 710,R130,81,01,140,81,01, 1,16, Do we make a play for 'er, colonel, or is this just a look-see? dowemakaplaforer3kernel3oristhisjusalookse R235,81,01, You'll have to make the call, $C, but I'd say engage. yulhavtomakthecal3dipstik3butidsayengaj R140,81,01,130,81,01, Even if it turns out to be a Fralthi... evnifitturnsowttobeafralthe R81,01,130,81,01,A40,81,01,A30, ...she'll never be as vulnerable as when she first jumps in. shelnevrbeasvulnrabulaswhnshefirsjumpsin R130,81,01,A40,81,01,A50,81,03, Anything else? anethanels R130,81,01, All right, then, let's get out into space. alrit3then3lesgetowtintospas 15,R81,01,A40,81,01,A35, Squadron dismissed. skadrundismsd $ Z ' k Z Z c P P P 6y P F Z xP CP YZP Z ABP NZ n2 P b2 2 1 Hg 2 3Oa2 qx2 d $d d d Mission debriefing. $T hours, $D. I haven't seen the mission report, $C. What did you find out there? ihavntseenthemisnreport3dipstik3whatdidufinowtthir 1,12,1,3, One of the big cruisers, Colonel... wonafthebigcrusers3kernel 120,81,02,RA30,81,01,A40,81,01, It was a Fralthi, sir, with Gratha flying escort. itwsafralthe3shar3witgrathaflingeskort A15,R81,01,A50,81,01,A35, A Fralthi, eh? Did you destroy it? afralthe3eh5diduengajit 225,R81,01,A45,81,01,A35, 1,9,1,6, Yes, sir We took the monster out yas2shar4tookthemanstrowtaswel R135,81,01,140,81,01, 1,7, Yes, sir. Took the monster out. yas2shar4evnmanajtodestroyit A5,R81,01,A30,81,01,A40, Really? Excellent work reale5eckselintwerk 515,81,01,A25,R81,01,A35,81,01,A40, That's just the sort of initiative mankind's going to need to survive. tatsjusthesortafinishativemankinsgoingtonedtosurviv A5,R81,01,A35,81,01,A40, 1,14, No, sir. With the Fralthi and all those Gratha together... nosar5witthefraltheandalthosgrathatogethr RA45,81,01,A35,81,01,A30,81,02, ...there didn't seem to be any point. therdidnsemtobeanepoint RA45,81,01,A35,81,02, I thought it would be best to return and report. ithotitwudbebestoretrnanreport RA40,81,01,A35,81,01,A40,81,01, 3,14, Nothing, sir. The fighter cover was too heavy. idonno2shar5thefitrcovrwastoheve RA45,81,01,A35,81,01,A50,81,02, Didn't get to see anythingbefore I had to break off and come home. didngettoseitbeforiwasfarcdtobrekaffandcumhom RA45,81,01,A35,81,01,A50,81,02, 3,17,0,17, Bhurak Starkiller was leading a wing of Salthi to intercept us. kajathefangwasledingawinofsalthetointercepus RA35,81,01,A30,81,01,A40,81,01, 1,17,1,16, 0,16, The furry bastard stopped us cold thefurebastrdstopduscold 640,R81,01,A30, We never made it to Nav 1. wenevrmadittonavwon RA35,81,01,A30,81,01,A40,81,01, I see. Well, $R, why don't you give me the numbers for the mission? ise5wel3shepdip3whidonugivmethenumbrsforthemissn RA45,81,01,A35,81,01,450,81,02, 1,21,19, Hunter knocked down $L of them. huntrnokeddonsumofthem RA30,81,01,A35,81,01, 20, Hunter struck out. huntrstrukowt RA30,81,01, 1,21,21, Everyone has an off day, mate evrywonhasanaffda3mat 130,R81,01,A40, 22, I managed to take out $K myself. imanajdtotakowtsummisef RA35,81,01,A30,81,01,A40,81,01, 23, I came up empty. icamupmpte 430,R81,01,A30,81,01,A40, 1,24,1,24, Hunter didn't make it back. huntrdidnmakatbak A35,R81,02,435, 1,25, Bhurak Starkiller is out... permanently. wenaildkajathefang RA35,81,01,A40,81,01, 1,26, And the Fralthi was destroyed. anthefralthewasdestroyed RA35,81,01,A40,81,01, 27, All right, $C ... I'll want to see you in my office in an hour. alrit3dipstik3ilwantoseuinmiafisinanowr RA45,81,01,A35,81,01,A50,81,02, Dismissed. dasmasd A N K A2 2 JUA 4A vA A A 2,4,3,4, Hey, $C. I hear you ran into Khajja the Fang out there yesterday. ai3diptik5ahiruranintukajatefanawteryestirday 245,R81,02,A45,81,01,A35,81,01,A50, 2,2, Colonel said you did him in kernalsedudidimin RA45,81,01,A35,81,01,A30,81,02, 2,3, Too bad he got away... tubadigatawai 81,01,435,R81,01,A40,81,01,250, Man, that hairball's needed killin' since I was a rookie. man3datarbalsneedidkilinsinsawasaruki RA35,81,01,A35,81,01,A40,81,01, One of the pilots from Killer Bee squadron was in earlier... wanaftepilatframkilarbeescwadranwasinirlir 235,R81,01,A35,81,01,A50,81,02, 0,6,1,7, ...said that both Dakhath and Bhurak Starkiller may be here soon. sedatbotdakatanburakstarkilarmaibeirsun RA45,81,01,A35,81,01,A50,81,02, 0,9,1,8, ...said that Kilrathi ace Dakhath would be comin' to Hell's Kitchen soon. sedatkilratiaisdakatwudbecumintufenasun A10,R81,01,A35,81,01,A40, 0,9, 1,9, ...said that ace Bhurak Starkiller would be comin' to Hell's Kitchen soon. sedataisburaktarkilarwudbecumantufenasun RA45,81,01,A35,81,01,A20,81,02, 0,9, ...said the Kilrathi'd be sendin' their top aces after us soon. sedekilratidbesendintertapaisisaftirasun RA45,81,01,A35,81,01,A20,81,02, Thought you might like to know, so you could keep an eye out. totumaitliktuno3soucudkeepaniawt RA45,81,01,A35,81,01,250,81,02, K I K K gF K $cK K gK wWwwQwQ 6,1, $C, have a seat. Lt. Marshall and I were just discussing tactics. diptik3hafaset5lutinantmarsalandiwerjusdescasintatics RA45,81,01,135,81,01,230,81,01, 6,2, $C, have a seat. I'd like to talk tactics with you. diptik3hafasit5idliktutaktakticswitu RA45,81,01,235,81,01,250,81,02, We're likely to be coming up against an increasing number of big ships. wirliklitubecaminapagintanincrisinambriafbigsips RA45,81,01,235,81,01,A50,81,02, It is important to know how to approach them. itisimpartantunoawtuaprostem R245,81,01,A35,81,01,230,81,01, When attempting to destroy a large ship, such as a Fralthi... wenatemtintudestroialargsip3susasafralti R81,01,A35,81,01,A40, ...I prefer to attack from the rear. iprefartuatakframterir R235,81,01,A35,81,01,A50,81,02, A large vessel's armor is always weakest around the engines. alargvesalsarmorisalwaiswekistarontenjins R245,81,01,235,81,01,250,81,02, 6,11, I hear the Kilrathi build 'em that way on purpose, Boss... ihirtekilratibildemtatwaianpurpos3bass 25,81,01,R235,81,01,125,81,01,220, ...to make the captains keep their noses pointed toward the enemy tumaiksurtecaptinskepternosispointedowardenimi R115,81,01,230,81,01,220,81,02, I have heard that as well, Lieutenant... iafurdataswel3lewtinant R145,81,01,135,81,01,150,81,02, ...though I see no reason to believe Kilrathi captains are so cowardly. toisenoresantubelifkilraticaptinsarsocawardli RA45,81,01,235,81,01,250,81,02, w H o w wXywwXwxww;lw;l 2,1, The Bossman here might like to come at a big ship from behind... tebasmanirmitliktucamatabigsipframbein R225,81,01,115,81,01,A30,81,02, 2,2, A lot of flyers will tell you to come at a big ship from behind... alataflirswiltelutucamatabigsipframbehin 81,01,115,R81,01,A25,81,01,120, ...but I like to approach the big ones from the side. batiliktuaprostebigwansframtesid RA10,81,01,A25,81,01,420,81,02, They've got all their missiles to the front... teyfgataltermisaltutefrant R81,02,125,81,01,A15,81,01,130, ...and most of their guns to the front and the back. anmotaftergantutefrantantebak R215,81,01,435,81,01,120,81,02, 2,6, True enough. truenuf R145,81,01,A35,81,01,A50,81,02, If you come in from the side, you'll have time to get in close... ifucaminframtesid3ulaftimtugetinclos R215,81,01,A25,81,01,110,81,01, ....then you can really let the sucker have it tenucanrililetesukirafit$30 R81,01,A15,81,01,125,81,01,A20, 4 9 d ; h i K j k P P PQ 0d 2 5 P KL Z 1 x QR2 x Ue fg,, d Q P RS P 5 Z KL2 F 78g P 2 d ,d , Mission Briefing.Hell's Kitchen System, $T hours, $D. I know everyone's giving all they've got... ...but the Kilrathi keep throwing more at us. butthekilrathekepthrongmoratus Sector Command has ordered the evacuationof civilians from Hell's Kitchen. hicumanhaordrdtheevakuashunofsivilansfromhelskichin RA40,81,01,A30,81,01, I thought they were evacuating peopleTO Hell's Kitchen, sir, not from it... ithottheywirevakuatinpepultohelskichin3shar3notfromit A10,R140,81,01,135,81,01, They were, $C. But the Kitchen turned out to be just a stopover. theywir3dipstik3buthtekichinturndowttobejusastopovr 140,R81,01,A40,81,01,A30, So it's our job to hold the system as best we can... soitsarjahbtoholthesistimasbesaswecan A15,R81,01,240,81,01,135, ...to cover the Confederate retreat. tocovirtheconfedaratretret RA40,81,01,A30,81,01, Right now, several of our vessels are under attack around the system. ritno3sevralofarvesilsarundratakarownthesistim R81,01,140,81,01,235, We'll be sending wings out to help in their defense. welbesindinwingsouttohepinthirdefns A20,R81,01,240,81,01,235,81,01, $C, you'll fly Mu Wing to assist an Exeter-class Destroyer. RA40,81,01,A30,81,01, 1,13, Hunter will fly on your wing again. $99 R240,81,01,230,81,01, Once more into the breach, mate onsmorintothebrech3mat$10 R81,01,A40,81,01,A30, Here's the situation... herstesituashun The Exeter is currently at Nav 1... You'll head straight for her, and help in her defense. She's under attack by at least four Dralthi... 1,18, ...apparantly led by the Deathstroke, Dakhath. aparentleledbythedethstrok3dakath So I want you to get over to that Exeter as fast as you can. soiwanutogetovrtothateckseterasfasasucan RA40,81,01,A30,81,01, If you're intercepted, simply evade and proceed to Nav 1. ifyurintrcepted3simpleevadanprocedtonavwon R81,01,A40,81,01,A30, You are not to engage any enemy vessels en route, understand? uarnottoengajanenemevesilsanroot3understan R81,01,A40,81,01,A30, 1,22, Aw, colonel, that takes the fun out of it aw2kernel3thattaksthefunowtofit 410,R81,01,230,81,01,A40, I understand, sir. No distractions, no delays. iunerstan3sahr4nodistrakshuns3nodelas A5,R140,81,01,A30,81,01, Good. Any last questions? gud4anelaskwesshuns All right, then. Let's get out there. alrit3then4lesgetowtthir Squadron dismissed. skwadrundasmasd $ - a ; D ; Ln; ; ,; ; 1V G vw F F CDr F 2 EFS F Lx2 2 2 6;k 2 2 2 2 -Lb 2 2 2 Mission debriefing. $T hours, $D. 2,11, I just spoke to the commander of the destroyer, $C. ijusspoktothecumandrofthedestroyer3dipstik Excellent job. He was very impressed. eckselintjahb5hewasvereimpresed RA25,81,01,A35,81,01,A30,81,02, Did the best we could, sir. The gunnerson the destroyer get some credit, too. didthebeswecud3shar5thegunersonthedestroyergetsumcrdit2too RA35,81,01,A35,81,01,A30,81,02, 1,11, Did you run into that furry bastard, Dakhath? didyourunintothatfurebastrd3dakath RA25,81,01,A35,81,01,A30,81,02, 1,7, No, sir. If he was out there, I never saw him. nosahr4ifhewasowtthir3inevrsawhim RA35,81,01,A35,81,01,A30,81,02, 1,8, I'll wager 'e turned an' ran when 'e heard we two were on the job ilwajireturnedanranwhenehirdwetoowironthejahb R125,81,01,135,81,01,130,81,02, 1,11, Bloody right, we did. Gave 'im what for, as well. blooderit3wedid5gavimwhatfor3aswel RA25,81,01,135,81,01,A30,81,02, 1,9, Yes, sir Took him out, too. yessahr4tookhimowt2too R125,81,01,135,81,01,130,81,02, 1,10, I saw him, sir, but he managed to flee intact. isawhim3sahr3buthemanajedtofleintakt RA25,81,01,A35,81,01,A30,81,02, Good work, $C. gudwerk3dipstik RA35,81,01,A35,81,01,A40,81,02, 2,18, Tactical picked up the Exeter's destruction on sensors. taktikalpikduptheecksetrsdestrukshunonsinsirs RA35,81,01,A35,81,01,A30,81,02, Every warship we lose costs civilian lives... evrewarsipwelooscosssivilyunlivs RA25,81,01,635,81,01,A40,81,02, ...because we won't be able to protect all the refugee transports. bekaswewonbeabeltoprotekaltherefugetransports RA25,81,01,A35,81,01,A30,81,02, I know, sir. ino3sar 430,81,05,RA25,81,01,A35,81,01, 1,18, 1,18, At least you managed to take out that rabid fleabag, Dakhath. atlesumanajdtotakowtthatrabdflebag3dakath RA35,81,01,A35,81,01,A30,81,02, That doesn't make up for the Exeter, but it was good work. thatdosnmakupfortheeckseter4butitwasgudwerk RA35,81,01,A35,81,01,A30,81,02, Thank you, sir. tanku2shar 430,81,05,RA25,81,01,A35,81,01, Well, let's review the mission report. walp3latsrevutemisnreport RA45,81,01,A35,81,01,A30,81,02, 20, You took out $K of the Kilrathi fighters, $C... yutukowttrekalratefitrs3dipstik 21, That's no kills for you, $C... tatsnokalsforyup3dipstik 22, while Hunter got $L. wilhuntrgatsavn 23, and Hunter came up empty. adhuntrcamapamte 1,24, The fuzzballs took Hunter out. tefusbahlstukhuntrowt RA35,81,01,A35,81,01,A30,81,02, 25, Be in my office in an hour, $C. beanmiafasananowr3dipstik RA25,81,01,A35,81,01,A30,81,02, That's all, then. Dismissed. tatsalten6dasmas 2 $ 2 a b 2 sK K SyK Z e2 2 Seen the news on the trid lately? senthenoosonthetridlatle 210,R81,02,A35,81,01,A25,81,01,A30, Looks like the Kilrathi are startin' to land marines on Toadstool. looksliktheklrathearstartintolanmareensontodstool RA35,81,01,A25,81,01,A30,81,01, That's the only habitable world in the Hell's Kitchen system, you know. thastheonlehabitabulworlinthehelskichinsistim4unow RA35,81,01,A25,81,01,A30,81,01, If the Kilrathi can push our people off, we're finished here iftheklrathecnpusarpepulaff4wirfinisdhir RA35,81,01,A25,81,01,A30,81,01, They ran some footage of the fightin' on the planet... theyransumfootajofthefitinontheplanit R81,02,A35,81,01,A25,81,01,A30, ...and it wasn't pretty. anitwasntprite A40,R81,01,635,81,01,630,81,02, I don't think our boys can keep the Kilrathi off the civilians much longer. idontinkarboyscankeptheklratheoffthesivilyunsmuslongr R645,81,01,635,81,01,650,81,02, 3,8,1,8, Sure is quiet around the rec room these days. suriscwitaronterecrumtesdais R645,81,01,635,81,01,650,81,02, 2 B i 2 2 $q2 2 2 2 -.d2 2 2U2 2U I was thinkin', mate. There's somethin' we might want to try... iwastinkin3mait5tersamtinwimitwantutri R245,81,01,235,81,01,A50,81,02, 3,2, Iceman, 'ere, tells me tha' the furballs 'ave been plantin' mines around... niit2ir3telsmitatefarbalsafbinplantinminsarond 145,R81,01,A35,81,01,240, 3,3, I've 'eard the hairballs 'ave been plantin' mines around the system... afirdeharbalsafbinplantinminsarondtesistam RA45,81,01,A35,81,01, I was thinkin' we might try to use those mines to our advantage iwastinkinwemitrituustosminstuaradfantaj R245,81,01,A35,81,01,A50,81,02, If we're dogfightin' near a mine field, why not try to lead 'em into it? ifwirdagfitiniramanfild3winatrituledemintuit R81,01,240,81,02,235, There'll be more of them than there are of us... terlbemaraftemtanterarafas R245,81,01,A35,81,01, ...an' if we concentrate on the avoidin' the mines... anifwicansintraitanafoidintemans RA30,81,01,235,81,01,A30,81,01, ...while they're thinkin' of shootin' us, wiltertinkinafsutinas R81,01,A30,81,01,235, ...they might just run into a few mines by accident teymitjusrunintuafewminsbiacsidant 120,R81,01,A45,81,01,A35, A B g 56c 2 'o CDj Ah, $C, hello. ah3dipstik3helo RA45,81,01,A35,81,01,A50,81,02, Things are looking bad, aren't they? thinsarlookinbad4arntthey RA45,81,01,A35,81,01,A50,81,02, 10,3, I've heard they've begun to plan for the evacuation of this system. ivehirdtheyvbeguntoplnfortheevakuashunofthissistim R81,01,A35,81,01,A40, The Kilrathi seem to be everywhere lately... theklrathesemtobeevrywhirlatle RA45,81,01,A35,81,01,A50,81,02, ...and where they're not, they've left their mines behind them anwhirthirnot3theyvlefthirminsbehinthem R81,01,A35,81,01,A40, 1,6, Not to worry, mate Their mines'll blow up their ships as soon as ours. nottowore3mat4thirminslbloupthirshipsassunasars RA45,81,01,A35,81,01,A50,81,02, 1,8, Hunter thought their mines could be used against them... huntrthinksthirminscanbeusdaginsthem RA45,81,01,A35,81,01,A50,81,02, ...but I'm not so sure. butimnotsosur RA45,81,01,A35,81,01,A50,81,02, I say you can't be too careful when you're flying through a mine field isayucantbetoocarfulwhenurflinthruaminfeld RA45,81,01,A35,81,01,A50,81,02, z 6 n 9 H X 9 d ; g L -.h L L 9i 672 XXa d P O F ;g F P a F -P 9s F P Z ,3jd d Mission Briefing.Hell's Kitchen System, $T hours, $D. Well, ladies and gentlemen, it's all over. welladesangentlmin4itsalovr The last refugee transport has leftHell's Kitchen for the Home Worlds... thelasrefugetransporthaslefhelskichinforthehomworls RA30,81,01,140,81,01,240,81,01,A40,81,01, ...and we've been ordered to pull out of the Vega Sector. anwevbinordrdtopulowtofthevegasekter RA40,81,01,A30,81,01, The entire Confederate fleet is falling back to Proxima Centauri... teentirconfedratfletisfalinbaktoproksimasentarea R81,01,140,81,01,235,81,01,A30, ...to prepare for the defense of Deneb Sector. topreparforthefinldefensofdenbsekter RA40,81,01,A30,81,01, I need a volunteer wing to fly a mission that may well be suicide. inedavoluntirwingtofliamisinthatmawelbesuisid A10,81,02,R240,81,01,235,81,01, I won't ask for volunteers until I've briefed you all on the mission. iwonasforvoluntirsuntilivebrefedualonthemisin RA40,81,01,A30,81,01, Computer, display Psi. camputr3displasi The Tiger's Claw is currently here. There's a Kilrathi destroyer -- a Ralari -- near Nav 1, here, and closing. The Tiger's Claw is headed for her jump point here, at Nav 2. There are dozens of enemy fighters in the area. thirardosinsafenemefitrsinthearea RA40,81,01,A30,81,01, I need someone to head off the Ralari, and detain or destroy her... inedsumwontohedafftheralare3andetanardestroyhr 110,A10,210,R81,01,A30, ...while the Claw prepares for her jump. whiltheclapreparsforherjump R235,81,01,130,81,01,A40,81,01, I want to point out that there are no guarantees on this one. iwantopointowttharthirarnogarantesonthiswon R235,81,01,130,81,01,A40,81,01, The Tiger's Claw won't be able to wait for you once she's ready to jump. thetigrsclawonbeabeltowatforuonsshesredetojump R130,81,01,A40,81,01,235,81,01, Whoever volunteers stands a good chance of being left behind... whoevrvoluntirsstansagudchansofbeinlefbehin R235,81,01,130,81,01,A40,81,01, I'll do it, sir. I'll take that chance. ildoit3shar6iltakthatchans RA30,81,01, 1,23, 'At's the spirit, mate atsthespirit4mat R235,81,01, Colonel, I want to fly 'is wing. kernel4iwantoflihiswing 81,01,210,RA30,81,01, All right, then. It's decided. alrit3then4itsdesided This is a very brave gesture. Good luck out there, gentlemen. thisisavrebravjestir5gudlukowtthir3gentlmen 1,24, This is a very brave gesture, $R. Good luck out there. thisisavrebravjestir3shepdip5gudlukowtthir Squadron dismissed. skwadrondasmasd $ 1 U q r s P 9Y yz P 4gG U u Z P 6aF wxF F x Z . F DEr F 2 Lm 2 ns 2 2 F 1I P ij P ij Mission debriefing. $T hours, $D. 1,9,2,9, $C Glad to have you back on board dipstik6gladtohavubakonbord We were able to follow most of your engagements on long-range sensors... wewirabeltofolomostafyurengajmintsonlonranjsinsirs RA25,81,01,A35,81,01,A30,81,02, Brilliant flying...absolutely brilliant. brilyuntfling5absolutlebrilyunt RA25,81,01,A35,81,01,A30,81,02, If we'd all flown that well throughout the campaign... ifwedalflonthatwelthruowtthecampayn RA25,81,01,A35,81,01,A30,81,02, ...we might not have been chased out of the sector like this. wemitnotberuninowtofthesekterwitartalsbetwenarlegs 81,01,A30,81,01,610,RA35,81,01, Thank you, sir. Are we ready for the jump? thnku3sahr5arweredefortejump RA25,81,01,A35,81,01,130,81,02, Yes, $R, we should be making the jump any second now... yes2shepdip4weshudbemakinthejumpaneseconnow RA25,81,01,A35,81,01,A30,81,02, 0,16,1,16,2,16, Dammit, $C What are you doing in the hangar? damit3dipstik6whatarudoininthehangar R635,81,01,635,81,01, There's still a wing of Krants plugging the Claw with missiles thirstilawingofkrantsplugintheclawitmisuls R635,81,01,635,81,01, I know, sir. I was just too shot up. ino3sahr5iwastooshotup 430,81,05,RA25,81,01,A35,81,01, She would have broken up on me any second. shewudhavbroknuponmeanesecon A20,81,05,RA25,81,01,A35,81,01, It's too late to scramble more fighters to take them out. itstoolattoskrambulmorfiterstotakthemowt 410,R81,01,A25,81,01,A35, You better hope the Claw's gunners can hold those hairballs off... youbeterhoptheclasgunirscanholdthosharbahlsaff RA25,81,01,A35,81,01, ...because you just bet all our lives on it bekasyoujusbetalarlivsonit R635,81,01,635,81,01, We'll go over your numbers while we wait for it... welgovaryurnumbrswhilwewatforit RA35,81,01,A35,81,01,A30,81,02, 18, You took out $K of the Kilrathi fighters, $C... yutukowtsumklrathefiters3dipstik 19, No kills for you, $C... tatsnokalsforyup3dipstik 1,22,20, while Hunter got $L. wilhuntrgatsavn 21, and Hunter came up empty. adhuntrcamapamte 1,22, The damn fleabags took Hunter out. tedamflebagstukhuntrowt R635,81,01,A35,81,01,A30,81,01, That's all, then. It's all on the bridge crew from here... tatsalten5itsuptoothebrijcroofromhir F , J 2 j k 2 LK K LK K The Kilrathi scum have taken Toadstool... theklratheskumhavtakntodstool RA35,81,01,625,81,01,A30,81,01, Just heard the news. They've got complete control of the planet. jushirdthenoos5theyvgotcampletcontroloftheplanit R81,02,A35,81,01,A25,81,01,A30, Since Planck's Star and Alliance fell, that was our last world in the sector. sinsplanksstarandaliansfel4thatwasarlasworlinthesekter R81,01,A35,81,01,A25,81,01,A30, The order to pull out will have to come soon... theordrtopulowtwilhavtocumsun RA35,81,01,A35,81,01, Damn shame, too. Millions of people dead, dozens of worlds lost... damsham3too5milyunsofpepulded4dusensafworlslahst R81,01,A35,81,01,A35,81,01,A30, ...just 'cause the Empire of Kilrah can't stand havin' neighbors. jastcastheimpirofkilracantstanhavinnaybors A10,R635,81,01,630,81,01, 2 . 2 N O 2 8p2 2 U2 2 ;Aw2 2 G2 42 4 Ah, $R $N. Bonjour. a3shepdiplooser5bonjewr RA45,81,01,A35,81,01,A40,81,02, I have heard that the Kilrathi have sent all of their best against us now. ihavhirdthattheklrathehavsentalafthirbesaganstusnow R81,01,A35,81,01,A35,81,01,A30, Only our presence in this system prevents their control of the sector... onlearpresinsinthissistimpreventsthircontrolofthesektor 425,81,01,RA45,81,01,A35,81,01, ...so we will be facing only their finest pilots from now on. sowewillbefasinonlethirfinespilotsfromnowan R145,81,01,A35,81,01,A50,81,02, I have been reading the records of their leading aces... Ihavbinredintherecordsofthirledingases R81,01,A30,81,02,A35, 1,6, To date, Dakhath Deathstroke has destroyed 86 of our starships and fighters. todat3dakthdethstrokhasdestroyedatesiksofarstarsipsanfiters 130,R81,01,A45,81,01,A35, 0,7, Bhurak Starkiller has defeated 64 of our best pilots. burakstarkilerhasdefetedsiksteforofarbespilots R435,81,01,A35,81,01, 3,8, The Baron Bakhtosh Redclaw has 75 kills to his credit. thebarinbaktashredclahassevintefivkilstohiscrdit R81,01,A45,81,01,A35, 2,10, And Khajja the Fang leads the Empire of Kilrah with 99 victories. ankajathefangleadstheimpirofkilrawitninteninviktores R235,81,01,A35,81,01, Mon dieu, I hope that none of us will be his hundredth mandew4ihopthatnunafuswilbehishundreth 520,R81,01,A25,81,01,A35, 3 T t u Z Och, lad, I reckon this fight's just about over. ok3lad3irekonthisfitsjusabowtovr RA45,81,01,A35,81,01,A40,81,02, What a bloody disappointment it is, too... watabloodedisapointmintitis2too R81,01,A35,81,01,A30, 10,5, I spent me entire bloody life fightin' the Kilrathi... ispentmeintirbloodeliffitintheklrathe R645,81,01,A35,81,01,A50,81,02, ...and now they chase us 'ome, with our tails between our legs annowtheychasushom4witartalsbetwenarlegs R81,01,A35,81,01,A30,81,02, Bloody damn shame, 'at's what it is... bloodysdamsham4atswhatitis R445,81,01,435,81,01,450,81,01,